Conserved Protein Domain Family
DUF4618

?
pfam15397: DUF4618 
Domain of unknown function (DUF4618)
This family of proteins is found in eukaryotes. Proteins in this family are typically between 238 and 363 amino acids in length. There are two conserved sequence motifs: EYP and KCTPD.
Statistics
?
PSSM-Id: 317763
View PSSM: pfam15397
Aligned: 21 rows
Threshold Bit Score: 237.931
Threshold Setting Gi: 340370498
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81896418   96 LRNQRTSLQELYSHEGYLSKLNKELIKAILDTEDSVALSVREMLQQQSILGSIIDILEYSNKKRVQQLRSELQEWKEKEE 175
gi 821456385  30 VKFRKDSLAELKQNVDSLTVSNQELAKKIQDVEAFTAEKVRKLLRQQDVFGTLISTLEYANHIQMQDMKSKLEKWEAETK 109
gi 637343999 111 sKSRRHSLDELKHHSKVLLKKNLGLMEEIKEMDDETAKEARDLLQQYEMFGTVITTLWDSSQNQLGIAKSELLEKDKIVE 190
gi 973201044 132 IRSRKQAIAEFEKHYAALQETNLRLAQEIREEDRISAVRAREFLNQHEKLGDSIGGFDGWSRSQIGKAKADLEETESTLK 211
gi 611975996 104 LKFRRASLEELKKHVGSLTITNQELAKKIQDIEARTTGKVRKLLQQQDLFGTLISTLDFASHKEMERIKDKLQKWETQAS 183
gi 699248060 125 IEARKKSLEQYTKLKQDLKSNNEALKQEIISREDTTHVGVRKLLEKYERYTSASKVLERNHSNQVEAARKDLQTKAEMFA 204
gi 260819024 110 IKARMQTMDEYTKRYEYLLSENKKLQAEIQGTEKQTHRDTTKLLRKYEKCRGAVSTINSKFHEDLETAQADLEETTERLN 189
gi 149733516 103 LRNRRTSLQELRSHENFLTRLNGELVRNIQDMEDSAAQKVRAMLQQQDIFATVMDILEYSNNKKLQQMKCELQEWQEKEE 182
gi 731488088   6 LRNRRTSLQMLQNHENFLTKVNQDLVKTIQDMEDSTALKVREMLQQQTILGNVIDILEYSNKKRLEELKCELQEWEEKEE 85
gi 874467303  48 tqqKINAIEELKQRSARLEEANCRLMKDIQHTDASTAKRARDLLQQYEQFQMVKAETQTASQNRLDTARAELQEMEKTME 127
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81896418  176 SKTNSLQREVDQLNSEIQKASEEVNFLDTYMDHEYPVKLVQIASHIRQVQQAKDNQQDELDNLSEMRETILALFSNVIQE 255
gi 821456385 110 VRVNDLEQQLTKLKRKINNAQEELNFLSTYMDHEYPIKSLEIANLVRQVQGVKDSSQNELDELEEIRKNVLQTLSKKLMV 189
gi 637343999 191 KNVGKLDAEMARMNTKVQALQDEVNVLRSYMDKEYPVKAVQISSLMRSIRNLSERQQYELEDIEDLSRRFLETLSGKAFK 270
gi 973201044 212 KGLQGLEEQLNKLKTEVCEAQTELHTLKTYKDKQYPVKALRIAEMQREIVKLQETHQDEREDIQLLAQSEMGKLEKSFRR 291
gi 611975996 184 IKLNELQRQMTKVKAKIHKTKEELNFLSTYMDQEYPIKSVQIENLMRQIQDVKDNNQEDLEELEELGKEVLQMLSKKLMV 263
gi 699248060 205 NNISELANEAEYLDGKVQSYLYDLQVLRTYKDKEYPVKAMCIAKLTNNVGNLSTEHRMQLEELKRIINGERGKMEGHHVT 284
gi 260819024 190 RDLENLHGELRAVEQRLKLKQEELHVLVTYKDKEYPSKALKISGLETEIKDLAAEQEEELDELNRIILIERTSFERQKVA 269
gi 149733516 183 AKMRHLERQVEQLNARIHKTKEEVSFLSTYMDHEYPVRSVQIASLARQLQQVKDSQQDELDDLNEMRRKVLESLSNKIQK 262
gi 731488088  86 SQINYLEKQVEQLDAKIKKMHEEVNFLSTYMDHEYPVRLVQIANLLRQLQQTRDRQQDELDELSEMRKMVLQSLSNKIQR 165
gi 874467303 128 KNLGELQQQLDEATSNVQVLQDELSVLRTYTDVHYPKQALQIVLLLSDIQNLKKQQQDEIDKTEEMGKAVLEELEEKTRQ 207
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81896418  256 KKKKILKSLVVNTQKP-HENILLLKTLDRRRLQ-RCMVLFRELIEQMKEEIPILLSEVEQMCAELW-NPREAVYKDV-LL 331
gi 821456385 190 KSEKVLNIMAKRTILP-YQTALMKRTLSNQLLL-KQMVQFRVHIDRMKKELPKLKAQVKDLQMKRQ-DPREVIFANI-LL 265
gi 637343999 271 EEEHVFQTIAEKQLMQ-YQDGLTQMNRNNLELK-RQIAGQKELIAEMVKEVKELHRSIIKLHHSTG-DPRNVIFADV-LL 346
gi 973201044 292 TEDEMLSAVAEEKMTY-IPPGVEHMLFHNSVMK-KEIELHQKMISELEEKTQALEKTVQQLQQSRA-DIRKEIFCDV-FP 367
gi 611975996 264 NSEQVLYVMAKKIISP-YQVALMKRTLSNQQLL-KQMVQFRVHIDYMKEQLPKLKAEVKALERHRK-HPREVIFEDI-LL 339
gi 699248060 285 KTQEIVGSAARNAFDScTSRSLQQLSRKNQVLM-YEIVQNKQDIEELKIVVQQLQYEVDALANMREtNVRKFVFPELnIM 363
gi 260819024 270 DNQAMTSNVTEKSISA-MHGSLKDMALQNAVMK-KEIEVHRGERETLKQDISLLEAELKQLIKDPKsQVLQQIFPHF-FP 346
gi 149733516 263 KKRKLLRSLVVKTQSP-YEEALLQKTRDSQDIL-KCTGRFREFIKHFEEEIPILRAEVQQLQVQLQ-EPRDIIFADV-LL 338
gi 731488088 166 KEKGLLKSLVMKVLDP-HQEVLVQNTRDNQEML-KYMDEFRDFIDQFTEEMPLLRAQVQQLQAQIR-DRREIIFEDV-LL 241
gi 874467303 208 EQEELLQKVVEEVLLH-QDGLKQL-VINNHVLRrEI-RRQREIIKDLEEEISELQSSIQTLRQRAR-DPREVIFADV-FL 282
                        250       260
                 ....*....|....*....|..
gi 81896418  332 QRPKCTPDMAVELNIPVQEPFP 353
gi 821456385 266 RKPKCTPDMDVILNIPPEEILP 287
gi 637343999 347 RRPKCMPDMDVVLDIPTDEDFP 368
gi 973201044 368 RRDKCAPDMDVTLNIPREEWLP 389
gi 611975996 340 RKPKCTPDMDVILNIPQEEVLP 361
gi 699248060 364 DKATCQPDEEIYLDIPKLQLLP 385
gi 260819024 347 KEPKCTPDMDVVLDIPTQECLP 368
gi 149733516 339 RRPKCTPDMDVILNIPVEELLP 360
gi 731488088 242 RRPKCTPEMDVILNIPVEELLP 263
gi 874467303 283 RRPNSSGandprsrgcgtgdtl 304
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap