Conserved Protein Domain Family
Spo7_2_N

?
pfam15407: Spo7_2_N 
Sporulation protein family 7
Spo7_2 constitutes a different set of fungal and related species from those found in Spo7. This domain is found in general at the N-terminus. In many members the domain is associated with a Pleckstrin-homology - PH - domain.
Statistics
?
PSSM-Id: 317772
View PSSM: pfam15407
Aligned: 42 rows
Threshold Bit Score: 54.8386
Threshold Setting Gi: 366997937
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 74657382    15 LEQDSYTLEKLRHASATHVHITSRRFFIGPIPKNWLQSHRKSWYRKR--LSS-RDYRSRAVTFS 75
gi 74605188    38 IPKHSFTSHQLTYCSAVEISQSHRSVLIGGIPQIWNLQHSYNIFTIF--ERL-TDVRLRNRIKY 98
gi 74600611    12 IPKSSFTAFRLTYQNPKLLSDTSKCILLGSIPNLWLLDNKLGFFTGA--TNH-AKSKVKKRFKS 72
gi 74656147    33 IPRSSYIASLLTVLGADALSNYGKGVFVGGYPGIWHNDKPDLITELL--TRKdTNERVLQYSNd 94
gi 260951305   13 IPRDSFTAFRLMYAPADEVSKLSQCVFLGPVPDLWWGGEQMGLFASL--SHW-CKSSVKRNFNS 73
gi 190347881   34 IPSGSFTAYRLTYCSPQELSQSARTVFLGHIPNIWADEKSKNIFARA--THR-SKQSVQHSFRg 94
gi 575517517    6 IPRKSFTAFRLSYLSTPEISTTSKSVVLGKFPYIWFEDEGHGLLSET--VRS-AKDKARKALDd 66
gi 459368861   10 IPRSSYTASLLTFLTPDLLNECGKSLFIGGIPEIWHENKHDLLAEYL--KQK-VRDKYNESSDv 70
gi 150950988    9 IPKSSFTAFRLTYASAAQVSQLSKCIFLGKIPDVYSKDEGPSIYKELehEKV-STNNIHQFIsn 71
gi 448115298   12 LPKASFTAFRLIYQSSRSISESSKCVLLGKIPDMWVDDGSKAALPTR--T-Y-AKNKVKKKFRS 71
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap