Conserved Protein Domain Family
DUF4623

?
pfam15416: DUF4623 
Domain of unknown function (DUF4623)
This family of proteins is found in bacteria. Proteins in this family are approximately 470 amino acids in length. There are two conserved sequence motifs: HLL and RYL.
Statistics
?
PSSM-Id: 317777
View PSSM: pfam15416
Aligned: 5 rows
Threshold Bit Score: 722.757
Threshold Setting Gi: 503398236
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 506290148  27 DDYPVAPDTSSNmTVLNSIKLMNAGANGATVLQGVVDENTKTVTFPRIEPGTDFSNLKFEADLSPGAKLNQETYPVTFEE 106
gi 524594724  25 KELPSQVEQPYD-TEISAIKIVNAGADGTTVLEGRIDEENKMIDFKRIVPETDFSNLKVEATLSDGAVLENDVFDFSMDE 103
gi 503398236  26 DDFPEALDSGSNfTVIKSIKIVSAGETGNGVVEGVVNEDTKEITFPRLDTLTNFQNLKFEAELSNGATLDKEVYPVTFLE 105
gi 494934566  24 EDYPKSHIAPYD-TELLSIKITNAGADGNTVVEGTIDEDNKIINFPRLDMTTNFSALNLDAKLSDGATLQNSVLDFSMDE 102
gi 524173550  24 K-LPENKVYPYE-TQLISIKILNAGADGNTVVEGTINQDKKEITFPKLDKDSPFDKLRVEATVSEGAEITETVYDYSMEE 101
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 506290148 107 GQTEKVIVLKVLNSPRYREYLVKLRLKVPVFGADFENKTTYDFTsnP--LGNPIYDAFTGALTRGSGFDGQQVLIPRR-- 182
gi 524594724 104 ETTEKTLILRIKNHNRYKDYFIRVRKKVPVFGADWEKVKTYGFC--A--ATNNTYEHFNSGTTRWAGFDGEYVLVVSRkg 179
gi 503398236 106 GESEKTIVIKVQNLPRYREYLVKLRLKVPVYGADFSLPTVYDFS--AnkGPAAVYPAFAGQLTRGTGFDGKYVLIASRg- 182
gi 494934566 103 ETASKTLVLRIVNQKRYKEYFIRVRKRIPVYGADFEKPTVYDF------SGDNIYPDYGSLLTRCASYDGEHVLIVSRk- 175
gi 524173550 102 GIASKTQVIRIQNHQRYTDYFMTIKRRIPVYGADFENPVEYKF------LDASKIPGGTGSVSRCADFDGELVLIVKR-- 173
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 506290148 183 -E-APHLLNVSELKAGVINKIPLNITGVTLGTFTLNMAAQVNGHSYIANLSGNTAGSPLKIYHWTNPSLAPQVIANINVG 260
gi 524594724 180 gT-NPHLLKVSDLKEGKIEPIMLNNEGVTGGTYPIHSGAVIKGHTYVSNLSGGGKWSPLMIYYYETPASAPEVILNVTLD 258
gi 503398236 183 -TsGVHLLDVEKLKVNDKTPIPLSTTGVTGGTYSYNMAAQVNGHSYVASLSG-AATSPLKLYHWASPTSTPEVVADINVA 260
gi 494934566 176 -T-APHLLKVSELKKGEIKPIMLDLTGVTGGTYSYNMGALTNGHVYIASLSGSQA-SPLKIYYWDTPTSKPEVIADIKVS 252
gi 524173550 174 -T-PPYVLKYEDLKAGKIEPQELDMTGVEGGTFPVNCGFLANGHIYIASLSGAAV-SPLKIYYYETIASKPEVIGNFT-- 248
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 506290148 261 TITGAGVRYGDNFSASLDDQGNGYFFFGDNAGTKILRFDVANYTSV--TNPIAFAIPvA-AAGSWTSYNRIGNTSEYLFT 337
gi 524594724 259 TIDGANSRHGDNASFNLDENGNGYVFFGNNAATDVLRFTIRNWKEIdpASATVLGSD-S-KANSYITVNRIWGTDSYIFG 336
gi 503398236 261 AIPGAAARHGDNFSIALDANGNGYAFF-TSATSNIIRVKIENYNR---STEVSLIST-AtNYEQWSTVNLVGNTGTYIIG 335
gi 494934566 253 DIPGAGNRHGDNISVNIDKNGNGFIFFGDNASTKFLRLTVSNHKTI--GEPKVLTSS-A-DATMVTNVYRIEDTEQYVWS 328
gi 524173550 249 NIPGTTKRHGDAISGNIDKNGNGYIFFGDNGGTDFVRIKVTNHKTT--SEPTVLASN-A-NATANTYVYRIEDTDKYLWS 324
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 506290148 338 GHDAPVALVSEG---GTAAFTMSRTAIPVRGSDARVVYFNGERYLIVTTAarTGAEATN--FIVYDITKGE-NVKDALTN 411
gi 524594724 337 GIYMAPKIVDES---MSVQYALKPTSVAAQSTACQIISFNGERYLVTMTA--GRTEDVTptMNVYDITKGGdTLTDCLAK 411
gi 503398236 336 GHSKPISLIDAS---GKASHTFAVSTLPIGSADPRVINFNGERYLLTITIprGAPNGINsvLRVYNITRGA-TINDAFVA 411
gi 494934566 329 GVRLPVTLVDES---LGSKYAMNKSNLETEAVAPRIFTFNEERYLIVCSAgqGSASKATpsLVVYNLTKGS-TVAEAMQK 404
gi 524173550 325 GLRLPVTLSDENvtpGGASLPLDDNILPKESVAARMFTFNQERYLMACVAkfGSASKVTptLDVYNLTKGA-NAEEAMEN 403
                        410       420       430       440       450       460
                 ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 506290148 412 LNAQAlVKPVFEYSLMG-PVNTSPASQTGFYVKKDAMGNDVSLMLYAAASDAGFVFFEFQKK 472
gi 524594724 412 FEEGD-RKPVYSFILGG-GKSISPGTNLNYYIEKDAEGKDSKLYLFAARCDSGFAICEFPIK 471
gi 503398236 412 FEQTE-KKPVYEFLISG-ATNTAPGTQSGFYVVKDAKGKDQKLMIYGATTDAGFAIIEFPVN 471
gi 494934566 405 FDEGDnHNPDYKFILGG-SGNGAALAQTDYLIEKDENGKDAKLCIFGSRTDSGFVICEFPIK 465
gi 524173550 404 FKAAEsHKPDYSAIIGGdSGNTAPGISTNYHIVKDSNGNDEKLIIFGYRMNTGFVITEFGIK 465
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap