Conserved Protein Domain Family
LNP1

?
pfam15419: LNP1 
Leukemia NUP98 fusion partner 1
This family of proteins includes leukemia NUP98 fusion partner 1, the gene encoding this protein is involved in a chromosomal translocation with the NUP98 locus in a form of T-cell acute lymphoblastic leukemia.
Statistics
?
PSSM-Id: 317779
View PSSM: pfam15419
Aligned: 14 rows
Threshold Bit Score: 179.623
Threshold Setting Gi: 327268892
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 190359785   7 DDDDVSFAKWMSSFWGHSWREEDQRGLRER--HRLQATSHRKTSLPCP--LPVL-------P-RIPSSDCHPR--RHSHE 72
gi 334329546   5 DDDDVSFAKWMSSFWGHSWIDENERDLRNNreRRSQDIRARRTSLPCPtqFAALpmtsthgSsRVVPVSGHPR--RHSQE 82
gi 345310579   5 DDDDVCFAKWMSSFWGHSWMDEREGR--AQrrRRSQSLSDRRASLPSPaqLSVLhtprlpgS-SRAPSSGQLR--RHSQE 79
gi 823453650   5 EDDDIFFAKWMSSFWGHNLIDE-EKEGRGHkkRQAQLCSERRASLPAS--FSSLhttrlhaS-AKGSSSGHLRgsKEFQE 80
gi 50729662    5 EDDDISFARWMSSFWGHSLIDENEKEGRGHkkRQTRSLSERRASLPAR--LSSLhttrlhaS-AKGSSSGHLKgsKEFQE 81
gi 564376530   9 DNDDVSFAKWMSSFWGHSWRDKDERGLRDH--HRLQEASYRKASLPCP--FPAF-------P-SIAPSDCYPR--RHSHE 74
gi 426217377   9 DDDDVSFAKWMSSFWGHSWIEEDERGVRDR--RGSQDASYRKSSLPCPf--PVL-------P-RMMSSASHPR--RYSYE 74
gi 558168210   9 DDDDVSFAKWMSSFWGHSWIEEDERGLRAR--RGSQDTGYRKASLPCP--FPVL-------P-RVTSYDSHPR--RHSHE 74
gi 511905034   7 DDDDVSFAKWMSSFWGHSWIEENERGLRDH--HGPQNATHRKTSLPCP--FPVL-------P-RITSSDSHPR--RHSHE 72
gi 311270066   7 DDDDVCFAKWMSSFWGHSWIEEDERGLRDR--HGSQDAISRKTSLPCP--FPVL-------P-RLMSSDSHPR--RHSYE 72
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 190359785  73 DQEFRCRSHVRDyRKYSEDGSFKEPLESKGRSHSkIEKFSESFERQLCFRTKRSASLGPESRKERNERECLRM-EIKSRK 151
gi 334329546  83 DYGFQGHHHMKA-KICSQSGSLQGQMEPKGRSHS-IQEFSEHFEQQLCFRTKRSVSLEPEAKKERKERESLRI-STEAHQ 159
gi 345310579  80 DQEFRSYHPGKTcKT-------REPQGYDGRSHS-IQEFSESFEQQLCVRAKRSVSLEPEGGKARKEREGLRT-KTRSHK 150
gi 823453650  81 DQDVKCHCHRKAsRTPSADSS-----CPETRSNS-IQEFAESFEKQLHLKSKRSVSLQPEGAKERQEREKLHLrKSKSHK 154
gi 50729662   82 DQDVKYRHHKKAsRTPSADSS-----GPETRSNS-MQEFAESFEKQLHFKSKRSVSLQPEGMKERRER--LHLrKNRSHK 153
gi 564376530  75 DQASR---RMRYhRKCSVDGSFREPIEPPRRAHSkMQEFSESFAQHLCLQTKCSPA-GPKGRKERNERHCLET-NMRSYK 149
gi 426217377  75 DQGFRCHTQARDhRKCSGDGSFKEPLESKGRSHSkIQSFSDSFEQQLCFRTKRSVSLGPESRKERNEREHQFL-EVRSCK 153
gi 558168210  75 DQGFRCHNHMREyRKRSEDGPFKDPLESNRRSHSkTRAFSESFEQQLCFRTKRSLSLGHESRKERNERESLRM-ETRSRE 153
gi 511905034  73 DQGFQCHTHMLDyRKCSADESFKEALESKGRSHSkIQAFSESFEQKLCFRTKRSVSLGPESRKERRERECLRM-EIKSRK 151
gi 311270066  73 DQGFRSCTHMRDyRKRSGDGSFKEPLESKERSHSkIQAFSESFEQQLCFRTKRSVSLGPESRKERNEKECWRL-EMRSHK 151
                        170       180
                 ....*....|....*....|....
gi 190359785 152 KVEEERSSRKEEHGEAHMAPLFEK 175
gi 334329546 160 ETEERRKLKEKKQGEASMGVLTKK 183
gi 345310579 151 RVGERKGSKKEE-GEASVVFPAKK 173
gi 823453650 155 KMGEKSEARRERDEAESSEAPAKH 178
gi 50729662  154 RMGEKSEPGGAQKDESSEAIPAKH 177
gi 564376530 150 KVEDRRTSMKETPGDEPMAPLIEK 173
gi 426217377 154 KVEEKRSSRKEERGEAYLPTLSEK 177
gi 558168210 154 KAEERRSSGKEEHGEAPMGPLSEK 177
gi 511905034 152 KVEERRNPRKEEHGEAHMPPLV-K 174
gi 311270066 152 KVEERRSSRKEELGEAYIPALPEK 175
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap