Conserved Protein Domain Family
ODAM

?
pfam15424: ODAM 
Odontogenic ameloblast-associated family
Statistics
?
PSSM-Id: 317782
View PSSM: pfam15424
Aligned: 11 rows
Threshold Bit Score: 332.203
Threshold Setting Gi: 513021057
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 171704518  16 APLISQRLLSASNSHELLLNLNNGQLLPLQFQGAFNSWIPPFPGFLQ--QQQAQVSGRPQFTLSTLESFAGLFPNQIPLS 93
gi 395857268  16 APLVPQNLLSASNSNELLLNLRNAQLVPLQLQGPFDSWIPPFSGVLQq-QQQAHIPDPSQFYLPSQDWLARLFPNQMPSP 94
gi 513021057  16 APLIPQHLLSASNSNELLLNLNNGQLLPLRLQGPLNSWMPHFSSMPLq-QQQAPIPGLPQISLSTLDQLVGLFPNEIPFP 94
gi 348563587  16 APVIPRHLMSASNSHELLLNLNNGQLLPLRVQGPLAPWIPSFSGLPL--QQQAPIPGQPQISLPALNPLAGLLPNELPFP 93
gi 532095321  16 APLIPQRLLSASNSNELLLNLNNGQFLPLQLQGPFNSWIPPFSGILQq-QQQAGIPGQPQLSLSTLDQFAGLSPNQILFP 94
gi 752403634  16 APLIPQRLMSASNSNELLLSLNNAQLQPLQLQGPFNSWIPPFSGILQq-QQQAQIPGLSQFSLSALDRFAGLFPNQIPFP 94
gi 332233117  16 APLIPQRLMSASNSNELLLNLNNGQLLPLQLQGPLNSWIPPFSGILQq-QQQAQIPGLSQFSLSALDQFAGLFPNQMPFP 94
gi 655857851  16 APLIPQRLLSASNSNELLLKLNNAQLLPLQLQGPFNSWIPPLSGVLQq-QQQAQIPGLPQFSLPTLDRFVGLLPNQMPFS 94
gi 118403780  16 APLIPQRLMSASNSNELLLNLNNAQLQPLQLQGP---WIPPFPVILQqrQQQAQIPGLSQFSLANLDWFAGLVPNQRAFP 92
gi 296486495  16 APLIPQHLMSASNSNELLLNLNNAQLRPLQLQGPFNSWFPPFPGILQq-QQQNQVPGLSPFSLSTREWFAGLVPNQIFVP 94
gi 558189170  16 APIIPQRLLSASHSNELLLSLNNAQLQPLQLQSPFNSWIPPFSGILQ--QQQAQIPGLTPFSLATLDQVARLFPNQITFP 93
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 171704518  94 RQVGLAQGGQAGQPDLSQQQTPPQTQQSASP-MSYVVPVKVPQDQTQMFQYYPVYMLLPWEQP-QTVTSSPQHTGQQLFE 171
gi 395857268  95 GQLSFAQGAQAGRLDPSQAPTPVQPQRGPHQvMPYVFSFKMPQEQAQVSPYYPMYMLLPWEQPpQAATQLPPQPGPQQQQ 174
gi 513021057  95 RQVSFAQGAQTGQLDPLQPQTPSQTQQGPNPvMPYVFPFNTPQEQAQTPQFYPVYMFLPWEQPqQTTTQSPQQTGLQQLE 174
gi 348563587  94 RQVGFAQGAQTGQLDAAQLQTPSQATQGPNPvMPYVYPFKPPQEQAQ-VVYYPVYMLLPWEQYqQTATQSPQQTGPPLFE 172
gi 532095321  95 RQVGFAQGAQAGQLGPSQPQAPPQTQQGPNLmMPYVFPFKMPQEQAQMLQYYPVYMLLSWEQPqQTVTQSPQQTGQQKFE 174
gi 752403634  95 GQVSFVQGTQVGQQDPSQPQTPPQTQQGPNHvMPYVFSFKMPQEQAQMLQYYPVYMLLPWEQSqQTATQSPPQTGQQQFE 174
gi 332233117  95 GQASFAQGGQAGQVDPLQLQTPPQTQPGPNHvMPYVFSFKMPQEQGQMFQYYPVYMLLPWEQPqQTVPRSPQQTRQQQYE 174
gi 655857851  95 GQASFTQGAQANPMDPSQPQPPPQTQQGPNHvMPYVVSFKMPQEQAQMLQYYPVYMLLPWEQPqQTVTQSPPQTGQQKFE 174
gi 118403780  93 GQVSFAQVTEARQLDPSQPQTSPQTQQGPNYvMPSLLSFKMPPEQGQMLQYYPVYMLLPWEQAqQTAAQSPPQTGQQLFE 172
gi 296486495  95 GQVSFAQGTQAGQLDPSQPQTPQQTQRGPKNvMPSVF-FKMPQEQAQMLQYYPVYMFLPWEQPqQTVAQSPPQTREQLFE 173
gi 558189170  94 GQASFAQGNQVGQLNPSQSQAPVQTQPGPNNeMPYVFSFKMPQEQAQMLQYYPVYMLLPWEQPqQTVPELPPQTGQQQFE 173
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 171704518 172 EQIPFYNQFGFAppQAEPGVPGGQQhLAFDSFVGTAPETPGMPVEGSLLYPQKEPISFKHDNAGVFMPTTSPKPSTDNFF 251
gi 395857268 175 EQVSLMRIFFHL--LCFXVIPGGQQ-LAFDPLLGTVPEMAVMPVEGVIPFLQKEVINFRHDNAGVFVPPTSPKPSTTKLS 251
gi 513021057 175 EQMPFYAQYGYIpqPAETGVPGGHQqSALDHLLGRAPETVAMPAG-AIQYLQKEEVNFQHDKAGAFVPSTSPKPSTSNFL 253
gi 348563587 173 EQIPFDAQYGYItqPEETGVPGGQQqFILEPLLGTAPETVLMPGGEVIPFLQKEVVNFRHDKAEVLRHSTSPKPSTATVF 252
gi 532095321 175 EQIPFYTQFEYIpqQEEPGVPGGQQqLALDTLLGTAPETIVMPGGGVLPYLQKEVIKFRHDSAGAFMPSTSPTPSNTKAF 254
gi 752403634 175 EQMPFYTQFGYIpvQAEPVMPGGQQqLALDPLLGTAPETVVMPGGGVIPYLQKEVINFKHAKGGIFIPSTSQKPSTTNSF 254
gi 332233117 175 EQIPFYAQFGYIpqLAEPAIPGGQQqLAFDPQLGTAPEIAVMSTGEEIPYLQKEVINFRHDSAGVFMPSTSPKPSTTNVF 254
gi 655857851 175 EQVPVYTQFGYIpqQAEPDTPGGQQqASLDPLLGTAPGIAILPAGGVIPYLQKEVINFRHDSAAVFMPSASPKPSTANVF 254
gi 118403780 173 EQMPFYTELGYVpqQVEPVMPGGQQqPVFDPFLGTAPETAVMTAE-VLPYFQKEMIQFKHSNGGIFIPSTSQKPSTTNVF 251
gi 296486495 174 EQMPFYTEFGYIpqQVEPVMPVEQQqPVFDPFLGTAPEIAAMPAE-VSPYLQKEMINFQHTNAGIFIPSTSQKPSTTIFF 252
gi 558189170 174 EQMPFYTQFGYIpqQVEPVIPGGQKqLAFDAIIGTGPETAAMPAEGVMPYLQNKMINFKHANRGIVIPPTSQKPSTTNAF 253
                        250       260
                 ....*....|....*....|....*
gi 171704518 252 TSGIDPTIAP---EQKVKTDSLREP 273
gi 395857268 252 TSSVNPTVTPgflEEKAKTDKLEEP 276
gi 513021057 254 AMAVDPTIASvlpEEKamtdslrep 278
gi 348563587 253 TSGVDTTTASmlaEQKAKTDSLREP 277
gi 532095321 255 ASALNPTIASvlpEEKAKTDNLREP 279
gi 752403634 255 APAIDPTITPelmEKKAKTDYLKEP 279
gi 332233117 255 TSAVDRTITPelpEEKAKTDSLREP 279
gi 655857851 255 TSAIHPSLAPelpEEKAKTDSLREP 279
gi 118403780 252 TSTVDPTITPkvmEKKAKTDSLKEP 276
gi 296486495 253 TSAVDPIITReltEKKAKTDSLKEP 277
gi 558189170 254 ASAIDPTITPepmEEKVSGSNespa 278
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap