Conserved Protein Domain Family
DUF4628

?
pfam15429: DUF4628 
Domain of unknown function (DUF4628)
This family of proteins is found in eukaryotes. Proteins in this family are typically between 152 and 673 amino acids in length.
Statistics
?
PSSM-Id: 317786
View PSSM: pfam15429
Aligned: 14 rows
Threshold Bit Score: 345.985
Threshold Setting Gi: 768948482
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189040660   1 MFENLNTALTPKLQASRSFPHLSKPVAPGS-APL-GSGEPGGPGLWVGSSQHLK---N---LGKAMGAKVNDFLRRKEPS 72
gi 395530682   1 MFENSNTAPTPKLQPSRSFPHLSKSTALSS-TAL-GPMEPSGPGLRVGSSQHLK---N---LGKAVGAKVNDFLRRKEPG 72
gi 973134246 409 MFENSNAAHTPKLQNAKFASTVNKRSVASS-SSPaTPAEVFGSGPKTGSSQHLK---NafnLGKAMGAKVNDLLRRKEQT 484
gi 118404412 403 MFKNSNATQVPKLQQSHSLTQLTRL------AGS-TSSEPSGVSILAGSTQHLK---N---LGKAVGAKVNDFLRRKDNE 469
gi 556973787   1 MFENSNTACTPKLQHSKSLSLLAKSSSGTI-SSF-PATETTGPKM--GSTQHLK---N---LGKAVGAKVNDFLRRKETV 70
gi 597790111 428 MFENSnAAEQQK-QSLRM-------------AGV-VSSSPAGQKSggSSSQHLK---N---LGKAVGAKVNDLLRRKDPS 486
gi 528482725   1 MFENCnAADQPK-------------------SFR-PSDSSALSGSktGGSQHLKnafN---LGKAMGAKVNDLLRRKDPS 57
gi 961874670 272 slfensiaQKQSPQTSRAGQHSTRSLSVSAnSNS-GSTFIDSPSS--GGQQRLKnaiN---LGKAVGAKVNDLLRRKEPS 345
gi 768948482 323 MFENS-VAQQQSPQSSRAGQSSARRSVASVgPHL-GTSSADSPSS--GGQQRLKnaiN---LGKAVGAKVNDLLRRKDST 395
gi 908539453 427 MFENS-IAQQQSPQTSRPGPSSTRRSAAMTnSNP-GSSCVDSPSS--GGQQRLKnaiN---LGKAVGAKVNDLLRRKEPS 499
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189040660  73 SLGS-VGVTEINKTAGAQLASGTDAAPE----AWL--EDERSVlQETFPRLDPPPPITRKRTPRALKTTQDMLISSQPVL 145
gi 395530682  73 NLGNtAGVMEINKNAGATLSAPDDAPPG----SWQ--EEERSTlLEAFPRLDPPPPVTKKRTPRALKSPQEMLISPQPVV 146
gi 973134246 485 SLGD-IGVTEVNKNVGAVLSSTESSVQG----ISG--HSRTS--IDWIPRLDPPPATGKKRMPRALKTTQDMMISSDPVV 555
gi 118404412 470 K-GD-IGVTEVNKTVAAEWSSNDRTCSG----NLE--EGQMSKnLESFPRLDPPPASVKKRIPRALKTTQDMMISPNPIL 541
gi 556973787  71 NLGS-IGVTEVNKNVGAVLAVAENNSQV----TTSgtGGHKS--LDIFPRLDPPPPAARKRTPRALKTTQDMMISPDPVV 143
gi 597790111 487 SLGD-IGVTEVNKNVEAVWASLTEMGLG----TTA--NSHMS--LDSFPRLDPPPPTSKKRLPRALKTTQDMMISSDPVV 557
gi 528482725  58 SLGD-IGVTEVNKNVEPVWASLVDMSHG----TAR--NSHVS--LDSFPRLDPPPPTGKKRLPRALKTTQDMMISSDPVV 128
gi 961874670 346 HLGD-IGVTEVNKNVGAVWSCMDKLGHS----SAS--SHM----FDSFPRLDPPPPTGKKRVPRALKTTQDMMISSDPVV 414
gi 768948482 396 HLGD-IGVTEVNKNVDV-WSCMDQLNQTssnsYMS---------FDSFPRLDPPPPSGKKRVPRALKTTQDMMISSDPVV 464
gi 908539453 500 NLGD-IGVTEVNKNVGAVWSCMEQLSQT----AAS--SHITS--FESFPRLDPPPPSGKKRLPRALKTTQDMMISSDPVV 570
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189040660 146 SSLEYGTEPSPGQAQDS-----AP--T----AQPDV----PADASQPEATMEReERGKVL-------------------- 190
gi 395530682 147 SSLEYGAELLAGPPQEP-----PS--T----VPSLGep-vSEDNLGPESSTEL-PGSESL-------------------- 193
gi 973134246 556 TTAEVS-ETSYTSSPDK-----TPliK----KEKSLek-lEEEELGGETGLPIsCGPESK-------------------- 604
gi 118404412 542 SSPEKPLPATAEVPKETfsearAE--K----EKPLLtnhqQETLINGKGDGEIvDQTESV-------------------- 595
gi 556973787 144 TSTE-ATDTSFTAMPEC--------------IPLLTqg-iPQDKSAKEEEKPLtSKTNTEdrmkdinktesltdlsglqk 207
gi 597790111 558 ASPEVSD-SSLLSSPDKsrlisSS--KaqdqFQPCL----EEPGLEPETPSAAsTPLEIQ-------------------- 610
gi 528482725 129 ASPE----SSFVSSPDK-----TS--KekaeFQP------EESNIEKPPEADVdSQMEKK-------------------- 171
gi 961874670 415 ASPEPADSPPFLPSPDE-----TS--QgpneGSKSE----EKLPGGSEEQEersteitgqpslvenkadseteetkst-- 481
gi 768948482 465 SSPDHAE-PSPVASPNK-----TL--PdtkeELKVD----EEEPQDAEETEAQeSAQDQT-------------------- 512
gi 908539453 571 SSPDPVDSSSFPSSPEK-----TS--PitqeEIRNE----EEQQQGKEEEKRSsGPAERK-------------------- 619
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189040660 191 -PN------------------------------------GEV-------------------SLSVPDLIHKD-------- 206
gi 395530682 194 -PN------------------------------------GEV-------------------PLSVPDLIHKD-------- 209
gi 973134246 605 -EGe----------------------------------nSKEgvqgtssglgeenqedaphLLSVPDLIHKDe------- 642
gi 118404412 596 -KGn----------------------------------hLEE-------------------TLSIPDLIHKE-------- 613
gi 556973787 208 sREg----------------------------------iSET-------------------ILSVPDLLNKD-------- 226
gi 597790111 611 -IKeesgsaevkgqcgstda--vqmadglkeldaakedqSQV-------------------LRSVPDLIHKD-------- 660
gi 528482725 172 -PSvelnskptsav--------------mdernsedvdqSQM-------------------LLSVPDLIHKD-------- 209
gi 961874670 482 ------------------------------------tdevkegeeekgsseggeeerrhqlqLSVPDLINKDpple-sra 524
gi 768948482 513 -EEkvegekvdgtagggea----dvedggseggeeekhqLQL-------------------QLSVPDLINKDppqpesrd 568
gi 908539453 620 -PGadsetaeindnvdtviggeedgvevrsadegmdehvLQL-------------------QLSVPDLINKDpple-ska 678
                        330       340       350       360       370       380
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 189040660 207 -SQDESKLKMTECRRASSPSLIERNGFKLSLSPISLAESWEDGSPPPQ-ARTSSLDNEGPHPDLLSFE 272
gi 395530682 210 -SQSDFKLRTTEWRRVSSPSLSERNGLKLSLGPLGLTEPQEDGSPPPR-ARTTSLDNEGPHPDLLSFE 275
gi 973134246 643 iPQGRKQKPGGPESGMVSTPCLGKTGQPISISEDGFLENGSVDAGMSR-QR-PSCVDDEHHPDLLSFE 708
gi 118404412 614 --------KSEISLKVISSNHIETMSIKSSISQVELLEEEYNNVDLGLwPRNATLDTDSPHPDLLSFD 673
gi 556973787 227 -TLDLKLKTADSERKLSLP----KTHLKITLSEDDLLENGSEDSGVPR-YRNSSVDEEESHPDLLSFE 288
gi 597790111 661 -NLELKQKLNSMESRMASTPCPGKGGCRISLSEGELLENGSVDYKSs--rRSSNMENEEPHPDLLSFE 725
gi 528482725 210 -NLDPKKLANS-ETRMASTPCPGKGGCRISVTEGELMENGTVDY------RTLNLDNEEPHPDLLSFE 269
gi 961874670 525 kPCDVWQRASSPDSRLASSPILGKASCRISLGEEVLLGNGAPCSKD----SGGGTEEAEPHPDLLSFE 588
gi 768948482 569 kSNEVWVKVS--DSRLASTPCSGKTACRISLGEEVLLGNGAPCSKG----NAVSPEEFEPHPDLLSFE 630
gi 908539453 679 kQCDVWQKAPGPDLRLASTPCSGKTPCRISLGEDVLLGNGAPCSKA----TGGSAEDTEHHPDLLSFE 742
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap