Conserved Protein Domain Family
MRP-S31

?
pfam15433: MRP-S31 
Mitochondrial 28S ribosomal protein S31
MRP-S31 is the mitochondrial 28S ribosomal subunit S31. This family of proteins is found in eukaryotes. Proteins in this family are typically between 246 and 395 amino acids in length. There are two conserved sequence motifs: RHFMELV and GLSKN.
Statistics
?
PSSM-Id: 317789
View PSSM: pfam15433
Aligned: 27 rows
Threshold Bit Score: 217.664
Threshold Setting Gi: 312069333
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24212370   85 K--------KDLLDIIKDMKVDLS----TaNV----------KTPKPRGRKPSASLEatvdrlqk-apedppkKR-Nefl 140
gi 121954901  61 L--------NRLNELLSMMTTESE----V-QLvkk----vqlAKPAGQKREKRKGKKaderkqdsdsdsdsddEKpK--- 120
gi 157167772  61 L--------NRLNELLSMMTTESE----Vq-Lvkk----vqlAKPAGQKREKRKGKKaderkqd--sdsdsdsDD-Ekp- 119
gi 193596567  38 sskknqlaiDKLNNLLKTMKKGNDv-----EMppheskpielAKPRQLARKSEQNKQnidd------------skqNkpl 100
gi 752870064  89 ktkivkdtrlensEIIKTANAQTDlteyVnNMika----rklEKTINIAIQPKRKSKdsl-----------neVK-Hmsy 152
gi 345325082  73 K--------EKLINIIKGMKVELG----SkAVsqr----kknQLTSAQSRKLIQNVErvgsmyqk-atkdatlKR-Dspl 134
gi 195378634  64 A--------QRLNRLLGSMQMQTT----Dqlad------adfPRPGDANRRRREALK-------------------Qdaa 106
gi 158300747  68 L--------NRLNELLAMMNTESE----L-KLvkk----vdlPRPKGKKSQDKKASSdsdsd------sdaeeERpK--- 121
gi 568259887  71 L--------NRLNELLSMMNTESE----L-KLvkk----vdlPRPKGKKVKERKAAAeesds------dsdteERpR--- 124
gi 827555702  38 KtvkndpatEKIQELLKSMMAPPK----IsEAeyr----ekfATSPDTRRSKQVDEI----------------EVkTeki 93
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24212370  141 spELVAAASAVADSLP---FDKQTTKSELLRQLQQhee------------elrAQ-KDREKRrISftHIISNMKIAKSPS 204
gi 121954901 121 --DLTKATRKVAESLG---GDAKKTEAELLAKLLG------------------GQ-TAGGEG-ASlsDIITGMQVDKEGA 175
gi 157167772 120 -kDLTKATRKVAESLG---GDAKKTEAELLAKLLG------------------GQ-TAGGEGa-SlsDIITGMQVDKEGA 175
gi 193596567 101 geKLSDAATEVAQSIG---GDTNKTKSDLLNLLRIynne-----------pndSS-EKKVKSsVQldDLLSGMKIDRSQS 165
gi 752870064 153 ekKLKDAAENVASILG---GDKIRTTSDLLQKVLTsrvetlrkeqlahtnleeKS-PKHEEQqTN----------NRYSE 218
gi 345325082 135 spDLVAAAIAVADSLP---SDKQTTKSELLKQLKKhee------------eskEQaRQRESGsLS--NIIADMKISKPSS 197
gi 195378634 107 tkDVITAAKNIASMLGtgeNERKQTESELLAKLLGhsveggpdapqgddkstpAV-TAGTEKeLNlsELIVGMKIDRRQQ 185
gi 158300747 122 --DLAQATRKVATALG---GDAKRTESELLSKLLG------------------TA-APAADGeSNlnDIITGMVVDRKAQ 177
gi 568259887 125 --DLAQATRNVANSLG---GDPKKTESELLSKLLGs--------------------AGASEGgDSltNIITGMAVDRDAR 179
gi 827555702  94 eeSITKAATDVAQAIG---GDVKQTEAELLSRVLG----------------------KINQTsTTlsDLLVGMKVDRTVE 148
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24212370  205 GRASTrpqhqiqfDEDMDSSLKQEKPTDFRKR-----------------------------------------------K 237
gi 121954901 176 KKGKE--------VQLTRSNVVRKSIERKGAKgqeylgvaqsrer---------------------rrpveaihptgasV 226
gi 157167772 176 KKGKE--------VQLTRSNVVRKSIERKGAKgqeylgvaqsrer---------------------rrpveaihptgasV 226
gi 193596567 166 KKSVEf-------SAVDRAQRIRELLGHSSGDhqr------------------------------------------tkK 196
gi 752870064 219 KKSIIht----llKEYNNNNNKQPVVENSIARqllnesktsaklni--------------------qnndlkrshfkqdI 274
gi 345325082 198 SRNYMrpdhqiqfDEGH-GYLLQKEIAATRGQr----------------------------------------------K 230
gi 195378634 186 PQQ----------TEQTRGEYVRRTLASRPKSrsgdhtssqrpqr----------------------hikreaetfsgsV 233
gi 158300747 178 KAAQAsg----gdREPTRSTLVKKSIDSKRAKqrrteegrkrssa---------------------kqtahaapggpgsV 232
gi 568259887 180 EKA----------SDPTRSTLVKKAIDSKRSKqqqravddagmkqrsdlsskdrsdrkriakqqkqqqllqsspggpgsV 249
gi 827555702 149 PDEVQk-------KPDTREQQVKRLVSKAKTTeasptrysqrksayvpnd-----------rtrqgrdsnrsgtpqiteI 210
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24212370  238 -----------YLFKGKRLSIFA-DKAFADEPPEpeaSPSLWEiefaKQLASVADQPFENGFEEMIQWTKEGKLWEFPVN 305
gi 121954901 227 -----------KLFEGDSLNIFT-DPAALKDSPD---VLLTWKklqeRELRLAITHPPANYFQKMALWTEQGKLWKFPID 291
gi 157167772 227 -----------KLFEGDSLNIFT-DPAALKDSPD---VLLTWKklqeRELRLAITHPPANYFQKMALWTEQGKLWKFPID 291
gi 193596567 197 yrkpmdnympiNLFSSEPLGIFK-NFDTKKDFP----TLPTWDrlheKSLQTAVTHPPKNIYEQMIIWTEQGKLWKFPIN 271
gi 752870064 275 -----------NLWNGQPSHIFEnIGVPSQDIPE----LKTWTaleqRELKALTTYPPANIFQELILWTEQGKLWKFPID 339
gi 345325082 231 -----------GLFRGKSLNIFPtSEDTPEEESEtvaSLTLWDlefaKQLATINEQLPRNGFEEMIQWTKEGKLWEFPIN 299
gi 195378634 234 -----------NLYGGEPLGIFTkDSTKLLHSPD---MLSTWStlaeRELKLQAAHPPANYFEQMIQWTAQGKVWRFPID 299
gi 158300747 233 -----------KLFGEEPLGIFT-DQAALKESPD---KLRTWQrlneRELRLAVTHPPANYFQKMALWTEQGKLWKFPID 297
gi 568259887 250 -----------KLFDGEPLGIFT-DLASLKDISD---KLPTWQklqeRELKLSVTHPPANYFQKMALWTEQGKLWKFPID 314
gi 827555702 211 -----------DIFGGEPLGIFK------TTEPNygtKLDVWEnlkkRELSLATAQPPANYFQKIILWTNQGKVWKFPID 273
                        330       340       350       360       370       380       390
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 24212370  306 NEAGLDDDGS-EFHEHIFLDKYLED-FPKQGPIRLFMELVTCGLSKNPYLSVKQKVEHIEWFRNYFNEKRDILK 377
gi 121954901 292 NEQGLDEEAKvSFTEHIFLEEHLEPwCPKRGPIRHFMELVCVGLSKNYFITAQEKKEHILWFRDYFEQKKDLLK 365
gi 157167772 292 NEQGLDEEAKvSFTEHIFLEEHLEPwCPKRGPIRHFMELVCVGLSKNYFITAQEKKEHILWFRDYFEQKKDLLK 365
gi 193596567 272 NEQGMDDENNvFFAEHVFLEPLIDEwCPKKGPIRHFMELVCVGLSKNPFLSVEEKKDHLNWFRQYFYEKNQLLs 345
gi 752870064 340 NEQDMEEEQNvHFSEHVFMERHLKEwCPKSGPVRHFMELVCTGLSKNPYLTVEEKINHIVWYKDFFESKQDLLR 413
gi 345325082 300 NEAGFDDDGA-DFHEHIFLDKYLED-FPKQGPIRHFMELVTCGLSKNPHLSVKQKAEHIEWFRNYFHEKTDILK 371
gi 195378634 300 NEQDMHEEANvDFSEHIFLEQHLEGwCPNKGPIRHFMELVCVGLSKNPYVTAQEKKEHILWFRDYFEAKKDILK 373
gi 158300747 298 NEQGREAEATvPFTEHVFLEEQLEGwCPRKGPVRHFMELVCVGLSKNHYITAQEKREHIEWFRDYFEQKKELLQ 371
gi 568259887 315 NEQGRDEEQRvPFTEHVFLEEHLEPwCPKRGPIRHFMELVCVGLSKNHYITAQEKRDHIAWYRDYFEQKKDLLK 388
gi 827555702 274 NEQGLEEEQKiHFSEHIFLDTHLEDwCPKKGPIRHFMELVCVGLSKNPFYTAQEKKEHIMWYKDYFVTKKDLLT 347
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap