Conserved Protein Domain Family
UNC119_bdg

?
pfam15435: UNC119_bdg 
UNC119-binding protein C5orf30 homolog
UNC119_bdg is a family of eukaryotic proteins that probably plays a role in trafficking of proteins, via interaction with unc119 family cargo adapters. The family may play a role in ciliary membrane localization.
Statistics
?
PSSM-Id: 317791
View PSSM: pfam15435
Aligned: 6 rows
Threshold Bit Score: 352.257
Threshold Setting Gi: 768918947
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221271945   3 MDASGASRAPISVL--PAAEVKSTLKPEADKPRCSSTPCSPIKSTVSGYQILHMNSNYLVGFTTGEELLKLAQKWSSPDS 80
gi 167008674   3 VDINGVNRTNNSVP--STTEGSSPSKPDPEKPRCSSTPCSPIRRTVSGYQILHMDANFLVGFTTGEELLKLAHKCATTEE 80
gi 768918947   1 MDVRGGPGTHVSIL--PAAEIMATLKPEAEKPRCSSTPCSPIRGLVAGYQILHMDANYLVGFTTGEELLKLAQKWSEGPS 78
gi 731454465   3 VDINGESRSTLASLplPAAEASSPGKAEAEKPRCSSTPCSPMRRTVSGYQILHMDSNYLVGFTTGEELLKLAQKCTGGEE 82
gi 972954846   3 VDISGVSRTSMSILptPSSEINSPSKSEPEKPRCSSTPCSPIKRTVSGYQILHMDSNYLVGFTTGEELLKLAQKWSSTEK 82
gi 348503896   3 MDISGVSRTRVSIL--PTTDIKATLKPEAERPRCSSTPCSPIRGTVAGYQILHMDSNYLVGFTTGEELLKLAHKWSEGNP 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 221271945  81 SNT-------EALPSPIKKPVDLGLHRASRIYKAKSRYYQPYDIPAVNGRRRRRMPSSGDSCLKSIVSgEPSKALHGPLP 153
gi 167008674  81 NPG-------ESLPAFRSKQLESGLSRSSRIYKARGRQYQPYEIPAVNGRRRRRMPSSGDKCNKAVPY-EPYKAVHGPLP 152
gi 768918947  79 EKS-------PGTSPVVPKAVNVGAHRSSRTFKGKHRYYQPYDIPVAGGRRRRRMPSSSDT-LRSPAPgQSEPGLHSSLP 150
gi 731454465  83 SKG-------EAMPSLRSKQLDAGLARSSRLYKTRSRYYQPYEIPAVNGRRRRRMPSSGDKCTKSLPY-EPYKALHGPLP 154
gi 972954846  83 TAA-------EALPSPRTKPLDLGLHRASRVYKTKSRYYQPYDIPAVNGRRRRRMPSSGENSLKSSV--EPSKVLHGPLP 153
gi 348503896  81 EKArvsdavsSSIKSTVPKSVDLGIHRSSRIFKAKGRYYQPYDIPATNGRRRRRMPSSSDTFLRSLAHgESGRALHAPLP 160
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|....*..
gi 221271945 154 LCLLKGKRVYSKSLDYLNLDKMSLREPVDTEVLQYQLQHLNLRGERV 200
gi 167008674 153 LCLLKGKRAHSKSLDYLNLDKMNIKESADTEVLQYQLQHLTLRGDRV 199
gi 768918947 151 LCLLKGTRAQSKSLDYLNLDKIRIKESPDTEVLQHQLQHLTLRNECV 197
gi 731454465 155 LCLLKGKRAHSKSLDYLNLDKMNIKEPADTEVLQYQLQHLTLRGDRV 201
gi 972954846 154 LCLLKGRRAHSKSLDYLNLDKMSIREPADTEVLQYQLQHLTLRGERM 200
gi 348503896 161 LCLLKSKGTQSKSLDYLNLDKISIKESSDTEVLQYQLQHLNLRGERV 207
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap