Conserved Protein Domain Family
THRAP3_BCLAF1

?
pfam15440: THRAP3_BCLAF1 
THRAP3/BCLAF1 family
This family includes thyroid hormone receptor-associated protein 3 (THRAP3), which is a spliceosome component and a subunit of the TRAP complex which plays a role in pre-mRNA splicing and in mRNA decay. It also includes the transcriptional repressor Bcl-2-associated transcription factor 1 (BCLAF1).
Statistics
?
PSSM-Id: 317794
View PSSM: pfam15440
Aligned: 30 rows
Threshold Bit Score: 233.116
Threshold Setting Gi: 765135083
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81882407  124 RSRSRSPKRRSP-S-PRSRSHSRNSDKSSSDrsrrsSSSRSSsn-hSRVES-SKRKSTKEKKSSSKDSRPSQAAGD-NQG 198
gi 557014576 104 prrgrsrsrtpkrrsvssprsrsrshhsdrssvsrgssssrssscysqsPVpSKLRSSLEKQPKKTEGVLSEDKASgSRQ 183
gi 972950365 107 sprrvrsrsrspkrrstsqrsrskshhsarssasrrssssrssslysrsPApAKSRGSQDKASKKSEGGKEEGSG---RQ 183
gi 847126751  98 sprrgrsrsrspkrrsassprsrsrsghsyksspsprssssrssskhskspviKIHTTQDKPGQKTEDYNKSESPA-NKS 176
gi 765146265 104 qgRSHNQQNRSG-S-P-PQGQSHRTDRSFSPlsrhsHHSSSSth-sSP--PkARQATGLASQTSEDVKDGELTSKQvQKG 177
gi 765135083 136 hsprrgrsrsrtpkkrspsrsrsrysdrsssgpsrhsrrssyssrshsssprhrssKGRRSSKDVKDKRTEGSAEKpgqv 215
gi 972974494 149 rsrsrysdrsssgrsrrtrgssssdsrsssthsrsgsskrnaakelkeSGR-PDSAAKEAQRAGSRDEEAAGAAGGegap 227
gi 611998464  85 ggryhrggyxskrrsvssqrsrsrsrrsyrssrsprssssrssspyskspvssKRRGSLEKQTKKPEGAPPEDSPLkNKS 164
gi 545177644 109 RSRSRSPKRRSV-SsQRSRSKSRrSYRSSrsp--rsSSS-RSsspySKSPV-SKRRGSQEKQTKTAEGEPQEESPLkSKS 183
gi 327277161 109 RSRSRSPKRRSRsS-QRSRSRSRRSYRSSrsp--rsSSSRSSsp-ySKSPVsSKRRGSSEKQAKKTEAATLQESPLkNKS 184
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81882407  199 DEAKE--------QtfsggtsqdikgsesskpwpdattygagsasrasvsdlSPRe-RSPalk-------------spLQ 256
gi 557014576 184 QEEKKdlgkfepdQsklhdefskvstlg-----------gdswpglsayndnSPRshQSP-------------------- 232
gi 972950365 184 LEEEK--------Gdgkaeqpaia-------------------tsaksdlkrTPAviTES------------------WI 218
gi 847126751 177 CDEQKda----fdPsepldelgkeldl---------------------------------------hgdtwaglsaydnS 213
gi 765146265 178 GEEDE--------Epeehvelleenptega-------gsgksdgnwqspkknS-------------------------LG 217
gi 765135083 216 geggniek---------------------------------asggkwidfdaSPKr-GSPdr------------------ 243
gi 972974494 228 drasgs-------------------------------------wqglidydtSPKr-TSPavrsaiivsqgtahpspsLQ 269
gi 611998464 165 QDEQK--------Dtfehdpsepiddfnks------saasgdiwpglsaydnSPRspHSP-------------------- 210
gi 545177644 184 QEEPK--------Dtfehdpsesidefnks------satsgdiwpglsaydnSPRspHSP-------------------- 229
gi 327277161 185 QEEEK--------Safehdpseplddfnks------aaasgdiwpglsaydnSPRspHSP-------------------- 230
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81882407  257 SVVVRRRSPRPSPV---------------------PKPSPPl-----------SnasqmgssmsggagyqsGAHQGQFD- 303
gi 557014576 233 -------SPVPTPTshsssr----------sdvalQSIAHSa-----------SgsskigaptqrshsiqrSPERAGSNt 284
gi 972950365 219 GISAYND---TSPHrspspiptppsqsssrsdtaaHQVASKi-----------Sppslpal---rlhslqhSPd------ 275
gi 847126751 214 PRSPCSPSPVTSPPshsssh----------sacpvMNVVRCa-----------Kdtlsen-----ihsivhSPEISGSGg 267
gi 765146265 218 PSSVGQKSPSPGQTintkis----------ndtsnGAPV----------------------------------------- 246
gi 765135083 244 ---kKEGTPSTSEGrgggas----------mwksvGSPSPP--------------------------------------- 271
gi 972974494 270 SVAVKR----PSPAvk------------------gGSPSPSrssaaaqskslgNapwqssgpaptsksppqQSPTAVFSg 327
gi 611998464 211 -------SPVATPPsqsssc----------sdapmLSTAHSa-----------Kntpsqh-----shsiqhSPERSGSGs 257
gi 545177644 230 -------SPIATPPsqsssc----------sdapmLSTVHSa-----------Kntpsqh-----shsiqhSPERSGSGs 276
gi 327277161 231 -------S-IASPPsqsssc----------sdahlLSTVHSa-----------Kdtpqhs------hsiqhSPERSGSGs 275
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81882407  304 --HGSGSLSPSKKSPV-----G-----Ksppatgsaygssqkee------------saasggaayskryleEQKT----- 354
gi 557014576 285 -----SRYSPSQDSPL-----HhmssrKspvksvtgqslsreeargrssfysdteekelpksgkylkrytdEEETgayll 354
gi 972950365 276 --DPLGHYSPSHDSPPyqtspR-----Rspakafstvqssrgffpn-------sdeqdlpkvgkylkryteEDGGraylh 341
gi 847126751 268 --NGLKRYSPSQNSPL-----Qms-tcKspaksvliqnpleeshyhysf--yadttkehanntkffdrytdE-ENklfpi 336
gi 765146265 247 --WQSSGGTCSTRKPS-----R-----Eglnpmlssfdffsteef---------qdedkkaisiafrkfleEQSKkan-t 304
gi 765135083 272 -----------PKSPA-----K-----Sgqsatfsgfgffskdda---------kpadnsaisaafkkflaENKSkkqaa 321
gi 972974494 328 fgFFSKDDVRAGEKPSsvstaF-----Kkf---------------------------------------leEHKNkiqva 363
gi 611998464 258 lgNGSSRYSPSQNSPIhhipsR-----Rspaktippqnvpreetrirsf--ypdggdqetaktgkflkrytdEESrvyll 330
gi 545177644 277 vgNGSSRYSPSQNSPIhhipsR-----Rspaktitpqnaprdeargrssf-ypdggdqetaktgkflkrftdEESrvfll 350
gi 327277161 276 lgNGSSRYSPSQNSPLhhipsR-----Rspakavasqnatreetrvrsf--ypeagepesskgakflkrytdEESrvyll 348
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81882407  355 --ENGKDKEqk-qtNADKEKLK----------EKGGFSDa---dVKMKSDPFAPKTDSEKPFRGSQSPKRYKLRDDFEKk 418
gi 557014576 355 dkSNVKEKDgqkdrGLDKGRVE----------QDSEWEDqealeYFEQKDSDKLPFLGDSEGEGGEKPDTYR---QFKVs 421
gi 972950365 342 erGNGRDKEhqkdrLQEKGRGE----------GD--WGDqggidPGVKKESEKVPFLGDSPDPEEDESQAYRQPYQFKVt 409
gi 847126751 337 ekCINKEKGtckerGTEKTKKG----------SSNVWDEhvaldYFLEKEPGNSQFLANSNSEDLEEAEDYR---QFRKs 403
gi 765146265 305 taEISPKTEae-dgGLEKGNMN----------GKTSAM-------------------VSDCASGKCKEKTKG-----EVs 349
gi 765135083 322 ekESSREKEal-aaDREQEKSS----------KSAEIFSv-----------------SSSAYADSKDDKSLPFFD----- 368
gi 972974494 364 ewENGREKEqk-maELERDKGNgkagsfdkgaAYSGLK-------------------------------------PDYYs 405
gi 611998464 331 drGNTREKEaqkekGTEKGRAE----------G--EWEDqetldYFsdkeagk-rkfndsEGDDTEETEDYR---QFRKs 394
gi 545177644 351 drGNTRDKEtpkekGSEKGRAE----------G--EWEDqealdYFSDKESGKQKFN-DSEGDDTEETEDYR---QFRKs 414
gi 327277161 349 drSNVREKDaqkerGPEKGRTE----------GEREWEDqdaleYYMDKDSGKQKFI-DSEGEDAEETEDYR---QFRKs 414
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81882407  419 -MAD----------------FH-------KEELD--EHDkdkskgrk-------epefddePKFMSKVIa-GASKNQE-- 462
gi 557014576 422 sQVE----------------QVksylaetRWNDD--DEG----------------------NKFKTKIVlkGDRDYDRfg 461
gi 972950365 410 tQAE----------------QVknypvesRWNVEsqEEG----------------------SKYKIKTSk-GERDYERfg 450
gi 847126751 404 vLAD----------------QGkslssvsNWNCE--EED----------------------SKYKTKGLtrFSKEGEKfk 443
gi 765146265 350 -LKS----------------FLktppflsTEGEE--EDEilhrpslkf----lfkdlhngdESCKPKIS------AQKlf 400
gi 765135083 369 ---------------------------------P--EEEeflksqglkervipddadaqrtP------------TARDi- 400
gi 972974494 406 kNEEekygyddefelgsaaeFLkgpqfgsAEAGE--DQEkrhkvrnq------keremedePKHKSKITi---TANRDmf 474
gi 611998464 395 vLAD----------------QGknfatasHRNAE--EEG----------------------AKYKSKVSlkGNRESDGfr 434
gi 545177644 415 vLAD----------------QGknfattsHRNTE--EEG----------------------PKYKSKVSlkGNRESDGfr 454
gi 327277161 415 vLAD----------------QGkgf-sasHRNAE--EEG----------------------SKYKSKISmkVNRESEGfr 453
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81882407  463 EEKSGKWES------LHTGKEkQRKAE--------EMEDEPFTER--SRKEErg------------gSKRSEs----Ghr 510
gi 557014576 462 EDRAFKLKGsgf-gaDRPSTSkEKY-----------REDDKFLERimIKREPvspe-------qvksEKLSErfdcsPl- 521
gi 972950365 451 EDRMFKFKNpg---yMLDRLNkDKYGEe-------gKGTDKYDERitIKRETvspq-------qakaERFREl----Fdq 509
gi 847126751 444 VVRGSKSAEq-------vAKEkHK---------------DKVTQRhsVMKDLlssd-------elkiEKTKDl----Fs- 489
gi 765146265 401 GEAFRKQQN--------AAYSqFTNGEf------dSREEERWVER----KQDkaaaisavlakreltEKFEDl----Spe 458
gi 765135083 401 ---fGKWGDepsistSYSSKEkARREAadp---sdAMEDEMYQVR--KLskkeekskkkekkekekqrrsaspqmkerpl 472
gi 972974494 475 DERFNKWDEla---yFPSAKEkLRKEEdageddidDVEEELY--R--SRKQEraaaaaaaakkaeasgyrgfspd----- 542
gi 611998464 435 EDKNYKLKEtgyvverpsttk------------dkhkeddksseRimVKKETqspe-------qvksEKLKEl---fDys 492
gi 545177644 455 EEKNYKLKEtgy-vvERPSTTkDKHKEd-----------DKSSERitVKKETqspe-------qvksEKLKDl---fDys 512
gi 327277161 454 EDKNYKLKEpasyvvERPNIPkDKHKEd-----------EKISERt-MKKETqspe-------qvksEKLKEl---fDys 511
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81882407  511 gfvpeknfrvtaykavqeksssppPR---K---TSEsRDKLGSKGDFssgk--ssfSI----TREAQVNVRMdsfd-edl 577
gi 557014576 522 ------------------------LQ---K---TLDlREKAASREENlpki-kmvpSE----SYRPDVKLKMppvsfddp 566
gi 972950365 510 s---------------------plLQ---K---TLDmREKAALRDESpprv-kivpGE----ASRPEVKVKIasla-ydd 556
gi 847126751 490 ------------------------YNltlH---ESNvIEKNIFREESpv-----kmRIvateSPLPEVKLRIitvp-ldd 536
gi 765146265 459 msfkkkm--------magspsvlaSA---A---VSSnREMFMIREQDpap----vsSQ----KPEAKFHVRMgflg-dsl 515
gi 765135083 473 fpgafppsdpspvrplsasredfelkfssleelpssslskdrliprdlpnsskkdpefrsifqhvqsaqlrrspselfaq 552
gi 972974494 543 --kapkasrkkekqgqspspparkSS---E---NRE-REMFNVRRDDspprstpaySG----KRSAEVSVRMdpfh-edy 608
gi 611998464 493 ----------------------ppLH---KnleA---REKStfreesp-lrikmiaSD----SHRPEVKLKMapvpldds 539
gi 545177644 513 ----------------------ppLH---K---NLDaREKSTFREESplri-kmiaSD----SHRPEVKLKMapvpldds 559
gi 327277161 512 ----------------------ppLH---K---NPDsREKSTFREESplri-kmiaSD----SHRPEVKLKMapvpldds 558
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81882407  578 aRPsglLAQERKLCRDLVHSNKKEQEFRSIFQHIQSAQSQRSPSELFAQHIVTIVHHVKEHHFGSSGMTLHERFTKYLKR 657
gi 557014576 567 vRPgtsLTSDRLLASALVHSGKKEQGFRSIFDHIKLPQMYKSSAESFIQHIVSLVHHVKEHYFKSTGMTLNERFTVYQK- 645
gi 972950365 557 pSPgtsLTSDRSLASALVHSTKREQGFRSIFDHIKRPQAYKNSAESFIQHIVSLVHHVKEHYFKSTGMSLHERFTAYQKA 636
gi 847126751 537 gRap-cLDNERLLGSTLIHSVKKVQAFRTIFDHLKVPFTSRTSPESFMYHVVSLVHHVKEHYFKGCGKTLNERFTDCLK- 614
gi 765146265 516 mSSsdiLAEERQLSQDLVLSSKKDPEFRSIFQHVQTAQSQRSPSELFAQHIVTIVHHVKTQHFPSSGLTLNERFTLYQRE 595
gi 765135083 553 hivsivhyikaqhfpssdislserfamyqrkaaeaemmkprkspeihrridvspsafkrhphlfedldessykdpgkkfk 632
gi 972974494 609 aSSsgvLANERRFSRDLVHPSKKDQEFRSIFQHIQSTQLRRSPSELFAQHIVTIVHHIKAQHFESSGMTLNERFAMYQRR 688
gi 611998464 540 nRPa-sLTKDRLLASTLVHSVKKEQEFRSIFDHIKLPQASKSTSESFIQHIVSLVHHVKEQYFKSAAMTLNERFTSYQKA 618
gi 545177644 560 nRPa-sLTKDRLLASTLVHSVKKEQEFRSIFDHIKLPQASKSTSESFIQHIVSLVHHVKEQYFKSAAMTLNERFTSYQKA 638
gi 327277161 559 nRPa-sLTKDRLLASTLVHSVKKEQEFRSIFDHIKLPQASKSTSESFIQHVVSLVHHVKEQYFKSAAMTLSERFTAYQKS 637
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81882407  658 GNEQEAAKNKKSPEIHRRIDISPSTFRKHGLTHEELKSPREpgyk-aegKY-KdDP-VDLRLDIERRKKH--KERDLKRG 732
gi 557014576 646 -ATEGQVPRQKSPEIHRRIDISPSALRKHTRLTDEDRLFKEesqkqgdkKL-RcDS-ADLRHDID--------RRRKERS 714
gi 972950365 637 A--EGHEVRQKSPEIHRRIDISPSAFRK-------DRILKEdsh--kgeKKsRcDA-ADLRHDId-------RRRKERSR 697
gi 847126751 615 -DTLDHVSHLRRPEIHRVIDIPPNIPKKHIRIQDEDKAIKKeta--kveKK-KkSSlSDQRCDVQ-HKKEhsKER----- 684
gi 765146265 596 AAEQEMKKSRKSPEIHRRIDVLPSAFKKPPQLFGGVKSSEEgtyksageKV-KgDT-MDLRLDIERRKKYscFQNQNQE- 672
gi 765135083 633 gdvmdlrldierrkrfagrerdykreggrspegsrgpsreqsteksgkhqkkskkskkkrdrspsssssssspspypppf 712
gi 972974494 689 AA--EMMKPRKSPEIHRRIDVSPSAFRKHSHLFEEMKSSREssskdegkKM-KtDS-MDLRLDIERRKKYssKEREHKRD 764
gi 611998464 619 --TEEHSTRQKSPEIHRRIDISPSALRKHTRLSGEERVFKEenqk-gdkKL-Rcdsadlr-hdidrrrKErsKER----- 688
gi 545177644 639 --TEEHSARQKSPEIHRRIDISPSALRKHTRLAGEERVFKEenqk-gdkKL-RcDS-ADLRHDIDRRRKErsKER----- 708
gi 327277161 638 --PEEHSTRQKSPEIHRRIDISPSALRKHTRLAGEERAFKEetqk-gdkKL-KcDA-ADLRHDIDRRRKErsKER----- 707
                        810       820       830       840       850       860
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 81882407  733 KSRESVDSRDSSHSRERsTE--KTEK---THKGSKKQ-KKHrRARDR-------SRSSSSSSQssHSYK 788
gi 557014576 715 REREGSRGSRESSGSRK-HE--KSTKdymDYKEYKPYkDESkPKNREgdhsrssssssasrddkdirke 780
gi 972950365 698 DRDDSRGSREPSPSRKL-DKlgKEFK---DYKDYKSYkDDSkHkskerersrsssssslsrednkdsrk 762
gi 847126751 685 --VDLTCSRESSNSQKK--E--KPQK---ELKEFKIFkEESkRKKDlgpphspssgssheekylkkese 744
gi 765146265 673 --RDVGDSADFSkelceqnlskhsnklngqkrrrsssssssssskspkpethetaklkdeelhktkacq 739
gi 765135083 713 rgkeyvgegmehpeenyghprypprdyggpgergprdyeghmaergrgrgffprirgrgwnrgnypgns 781
gi 972974494 765 GMRDSGESRGSSLSRERsTE--KSSK---HHKKTKKRk----KTRER-------SRSSSESSSssHSFK 817
gi 611998464 689 --GDSKGSRESSGSRKQ--E--KT-K---DYKEYKSYkDDSkHKSReqdrsrssssssssssassreek 747
gi 545177644 709 --GDSKGSRESSGSRKQ--E--KTPK---EYKEYKSYkDDSkHKSREqdhsrssSSSASPSSPssREEK 768
gi 327277161 708 --GDSKGSRESSGSRKQ--E--KMPK---DYKDFKPYkDDSkQKREQdrsrsssTSSPSSSSSssREEK 767
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap