Conserved Protein Domain Family
DUF4630

?
pfam15443: DUF4630 
Domain of unknown function (DUF4630)
This family of proteins is found in eukaryotes. Proteins in this family are typically between 124 and 286 amino acids in length.
Statistics
?
PSSM-Id: 317797
View PSSM: pfam15443
Aligned: 5 rows
Threshold Bit Score: 217.088
Threshold Setting Gi: 741873489
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 558100441  35 ALVGVLVAEAGPEDAVAPMLRLLEALLRTVFGRQAGGPVQAAAYCPGHPASSLAVQTAASRALQAAAPARPAEGAWERPG 114
gi 293349917 133 ALVGVLVADASAEDSGAPGLQLLETLLRRVFGRQVGGPVQAAAFRPGCPASSLAVQEAACRALQAAGPGRPAEGAWERPG 212
gi 297669675 290 ALVGVLVAEAGPEDAVAPALRLLEALLRAVFGRQGGGPVQAAAYCPGLPASCLAVQAAACRALQAAGAGQPVEGAWERPG 369
gi 511908136 132 ALVGVLVAEAGPEDTVAPGLRLLEALLRTVFGRQAGGPVQAAAYCPGHPASSVAVQAAACRALQAAGSSRPA-GPWERPG 210
gi 741873489 131 ALVGVLVAEAEPEDAVAPELRLLEALLRTVFGRQAGGPVQAAAYRPGQPGSSLAVQAAACRALQAAGPWQPAEGAWERPG 210
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 558100441 115 LPALLACFSWGPWSRGKDPYATASPSgPAQGNFREPEEELALTVILPNGDCEDPGKGSGACDGAAHTPAEPAGD 188
gi 293349917 213 LPGLLTCFSWGPRRQRKSQGVTSSQS-PVQEHLQVSEEELALTPVFPNGDCEDRGNGSRAQDGVVHMPPDPLGN 285
gi 297669675 370 VPRLLACFSWGPWSRRKNQDIAACRS-PAQEDFQEPEEELALTAVFPNGDCEDFGRGSKACDGVIHTPAEPTGD 442
gi 511908136 211 LPALLACFSWGPWSRGKDPDAT-SPSdPAQDHLQDTEEELALTTICPNGDCEDHRKGSRACDGLVPAPADPAVD 283
gi 741873489 211 LPALLACFSWGPWSRGKNPDTS-SRSgPAQGDLRDSEEELVLTAVYPNGDCEDPGEGSEPCDRIASAPTEPAGD 283
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap