Conserved Protein Domain Family
NTR2

?
pfam15458: NTR2 
Nineteen complex-related protein 2
NTR2 or Nineteen complex-related protein 2 is a family of largely fungal and plant proteins that form a complex with the DExD/H-box RNA helicase Prp43. Along with NTR1 it is an accessory factor of Prp43 in catalyzing spliceosome disassembly. Disassembly of the spliceosome after completion of the splicing reaction is necessary for recycling of splicing factors to promote efficient splicing. NTR2 and NTR1 associate with a post-splicing complex containing the excised intron and the spliceosomal U2, U5, and U6 snRNAs, that supports a link with a late stage in the pre-mRNA splicing process.
Statistics
?
PSSM-Id: 317810
View PSSM: pfam15458
Aligned: 83 rows
Threshold Bit Score: 105.088
Threshold Setting Gi: 156839240
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74685244  129 YSREYLSELKAATPTrAPRGVTDtieddnddvDSSGLSRLAREKYASSFAQD--------------------TTAGIPDA 188
gi 384872662 101 YSNAYVDELKRKSRQ-TPSEFTK---------KEEDSSTKESELQTRSSPPLpvnts----------lewnmLNQGIPEE 160
gi 588262515  90 YSQNVIEELKANTP--TKGDIEIsitd--didTEDGYSDIAKRI---YGDKAin----------------dlKESQIPSD 146
gi 968586050 128 YNSDYLSKLRLSTPS-TPKEFCNihke-nvdiDNLHITEKN----------Sqv----------------seEIPKILDE 179
gi 213401455  31 YSIEEMNELKSSVKE-TPKDYIMtnekesvivNQLPNDQLNKETITNNVPTSisse------------vsrmIDQGLPEE 97
gi 501751862  69 YSNDYLSELRHSTPT-IPRDFSEapih--ddlTT---------SIANEEEHDda----------------qtTVPKILDE 120
gi 401624893  78 YRNLYSSKEDVNTSK-VSKDDVVvlnm--edmMEGGHRSL-GE--LSEGGDSfe----------------eeHTINIPTP 135
gi 367004607  87 YNQLYNRKNRLNE---------Ipnen--vanANDNSNEKTNAIIINIEEMEqngli-----------epdnDDRGPKMK 144
gi 156839240  47 evkplklvkkrndedkrnaeiatsgkieeysdifhpSKNNDDSKILNLSDMSdvdvmdsk----tndcsisdNDNVIPSK 122
gi 401841183  56 kkvpkrkitfdgeqavkendsqykglyrskenMDTSKANKDDEVILNMEDMMeeghnllsylpdsggslegvHSISVPTR 135
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74685244  189 TTIAAAKMKRQ--AgmggngaA--TASAENEEDYISLGSGggki--aiyDAQQGPHPESRLMREED------E-----EG 251
gi 384872662 161 AMIKELKDREG--R-------K--RNIAMMTDNYISLETGdq------lMLAQNHKEEKLLQTEDEi----qDe----GY 215
gi 588262515 147 AAITAAKKKRQ-------------AGTYSNESDYISLSGGpsssqaltlTGDTGGGIESRLQHEDD------V-----FD 202
gi 968586050 180 GIVKALKERRA--Ek---------rEQNRLNNVYIPLEDDeq-----miLYS--KSNESRLQREDDif--dnD-----GI 234
gi 213401455  98 YIVKEMKERKI--Rr---------QNIAMTEDNYISLETGd-------aLYIPLKENKSLLQREDD------V-----LD 148
gi 501751862 121 STIRHVKEQRD--Irr----rA--G------ENFIPLADAld-----vhKSDPADRG-KRLQTEDVvdvlggD-----GT 175
gi 401624893 136 EEIVKLKAQKS--Isr----rNfnKSDTVREKDYVKLLDKed-----krELMETIKSNGGLKHTNE------K-----DI 193
gi 367004607 145 PSVKKMDKYNS--Ks------K--LNVMKEEKLYAKLLDDdd-----kiEIMEIIDKQGGLDKDND------K-----DA 198
gi 156839240 123 ELIERLKSERR--Klse--kpR--NFGKVNEREYVKLLDKdd-----evEIMEIIEKNGGKQKKNE------N-----DY 180
gi 401841183 136 EEIVKIKTEKSiyRrn----lD--KGDVIREKDYVKLLNNed-----krEIMETIKSNGGLKHATE------KevmnfSD 198
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74685244  252 EG-D--E----DLA---DYtgakdKlFLGKTANKAAARRLRGEIGELIADreAE-D-------E--DD----EETLEWER 307
gi 384872662 216 SG-F--E----NYV---EE-----SeKLQEIYHHSSESLRTRSIQMAVDQknMEmE-------L--DDediaEPIQSWEH 271
gi 588262515 203 DDtM--G----AYT---GAd---eSiHLTNQGEKDALRRQRRERGEMVDE--VMdE-------A--SD----EEQQAWEK 255
gi 968586050 235 EG-I--R----EYV---DD-----KiILSKDLKRAQDKQKYIEMKNSIEN--IQnS-------DinEDts-eEESSQWEQ 289
gi 213401455 149 NG-Y--G----DYEamiEDg-----lVITDQQKQQEAKLKEECIE---NA--AEqI-------V--ESen-nVDWGSWEA 201
gi 501751862 176 EG-L--D----GYE---SDs-----lPIGARNMRNAEARKREEMEILISE--RQeDggfnavlS--SEes-nDSDDEWER 235
gi 401624893 194 EN-FsdD----EMQ---DYqd--eRlALTDNQVAIQKDSKRRIIEEAIG------------------Dvc-yRVNEEWEA 244
gi 367004607 199 SG-F--DfnmtEFE---DD-----RlAVTDRERQIYKMKRKKLIEEALEV--N--H-------L--EDnt-rPNSNEWED 253
gi 156839240 181 IG-L--EldlgEFE---DN-----RlALSSKEKLLESERRKDEIMKAVE------V-------D--SQsh-eSDGDSWQE 233
gi 401841183 199 DE-M--R----DFQ---DE-----RlALTDNQISIQKDFKRKIIEEAISD--APyR-------V----------NEEWET 244
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74685244  308 AQAQRSglweekepekvvkkgytpapIPLSR-----PL----P---TV-------L-------S------AQSRLTKALS 355
gi 384872662 272 TQIKKGaf----------------geSPAFTnglsvKL----PnilTM-------D-------E------QIQRLKEAIA 311
gi 588262515 256 AQAKRAmagaheepa--ngnvyipapIPEIT-----PL----P---TL-------N-------G------AMKRLKNLRI 301
gi 968586050 290 TQIRKGvygsklinmn-lppskkhqpIPL-------EI----Q---TF-------E-------N------SINRLKTILS 334
gi 213401455 202 AQVRKGvynadqqe------mlrkqnrPQLA-----KI----P---TL-------Q-------E------QIQRLRTCIA 243
gi 501751862 236 TQTGKTgpasaras-----gqkdrsqPPILT-----PI----P---TV-------Q-------Q------SLDKLRQNVE 278
gi 401624893 245 QLLSKGnvl--------------kpnEKTIT-----AL----P---ILypkndvnG-------N------NIEAISEMVS 285
gi 367004607 254 QQLTKVfnnehlvaek-kdsrikalqSQLPH-----PIiledP---T----------------N------IIEYIRSIQI 302
gi 156839240 234 QIIKRStanvdslq-----dgnifdsKEFMV-----SL----P---TL-------S-------DdshlegIDIKLSEMMS 282
gi 401841183 245 QLLSKGnmlk--------------pneeTIT-----PL----P---IL-------FpgvnenrS------DIEEISEMVS 285
                        330       340       350
                 ....*....|....*....|....*....|....*
gi 74685244  356 DLEITKSHNDHNLDVVVQELADLEKQERELRIEVE 390
gi 384872662 312 SEKLQQEERSQIIKSLMEEELEINEQEEKIKHSFI 346
gi 588262515 302 EGEKTHGEKQKLSELSQKELQELSQSENEIRQQVE 336
gi 968586050 335 SMKSEKELMLSQIKTLISEKDDISKKEAIIKESLQ 369
gi 213401455 244 EEKLQQDERMKQLESVLAEEREIANREQMLRDSFK 278
gi 501751862 279 ATSKLIESKQIVINQLEQEELEIAAQEEAIKNGLQ 313
gi 401624893 286 KISFQRKKVEMRLQALQKAKIDLEETKVRLLDTLI 320
gi 367004607 303 DLEKKKQMLKIQQISLSNEVITLNEKIDSITKGLN 337
gi 156839240 283 SFTVRKKQLETQIKILENQKENTELNIIEILKKFK 317
gi 401841183 286 KIRLQGRKVEMRLQALERARMDLENSKANLINTLI 320
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap