Conserved Protein Domain Family
DUF4637

?
pfam15470: DUF4637 
Domain of unknown function (DUF4637)
This family of proteins is found in eukaryotes. Proteins in this family are typically between 142 and 178 amino acids in length.
Statistics
?
PSSM-Id: 317821
View PSSM: pfam15470
Aligned: 6 rows
Threshold Bit Score: 232.123
Threshold Setting Gi: 81898499
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81898499     5 GVKTPLWRKEVEDPEAREEDLEDDSSSSSSSSSveERSDPESATETE----EDSRDAEEREA---RSVSYSPLRQESSSQ 77
gi 1040201000  69 GAKTPLWKKELEKPRATEAEQEEAQEGSEEDDE--ERPPEERATEGS----EQPREAQEAEGhepRSVSYSPLRQESSTQ 142
gi 116268107    5 GVKTPLWKKETEELRAEDAEQEEGKEGSEDEDEdnQRPLEDSATEGE----EPPRVAEEGEGrerRSVSYCPLRQESSTQ 80
gi 821484982    7 GLKIPLWKKNPEEFLDNEVEEGDNEEEENSDEK--ESDEAENASEKEgdywESGQELQDGDGkdkGSVSYCPLRQESSAS 84
gi 940765668   45 GVKTPLWKKEPEEPGVREEEAEE--EGSEEEDE--GRQPPESAAAGE----AERREAEDAEGr-gGSVAYSPLRQEPSAQ 115
gi 338711579    5 GVKTPLWKKELEEPRAGEVEAEEAEEGSEEEDE--ARPPEESVAEGE----AESREAEGDEGq-rGSVSYCPLRQESSTQ 77
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81898499    78 QVALLRRSDSSFWGWLSPFALLGGLAAPADRKRGAPEEPCVLETRRRPPRRGGCARCEILFCKKCKTLHSHPAYVEHCIL 157
gi 1040201000 143 QVALLRRADGGFWGWLSPFGLLGGLVAPADRKRSLPEEPCVLETRRRPPRPGCCARCEILFCKKCRILHSPSAYVAHCVL 222
gi 116268107   81 QVALLRRADSGFWGWLGPLALLGGLTAPTDRKRSLPEEPCVLEIRRRPPRRGGCACCELLFCKKCRSLHSHPAYVAHCVL 160
gi 821484982   85 EVSSLRRSESGFWTWLSPLTLLSNLAFPVDRKRIQPGQMCLLEKQRT--NDGPCSRCEILFCRKCETLHCDPNYVEHCIL 162
gi 940765668  116 QVALLRRADSGFWGWLLPLALLRGPAAPADRRRNLPEEPCVLQTQGQPPSGGGCELCEILFCKKCRTLHSNPAYVAHCIL 195
gi 338711579   78 QVALLRRADSGFWGWLSPFALLGGLAAPADRKRSLPEEPCVLETRREtPRGGGCARCEILFCKKCGNLHSHPAFVAHCIL 157
                         170
                  ....*....|..
gi 81898499   158 EHPDLGKAEATG 169
gi 1040201000 223 EHTDLGKAGAAG 234
gi 116268107  161 DHPDLGKAGAAG 172
gi 821484982  163 DHWEGGAsdree 174
gi 940765668  196 EHPDLGEARAAG 207
gi 338711579  158 EHPDLGEAPASG 169
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap