Conserved Protein Domain Family
DUF4638

?
pfam15472: DUF4638 
Domain of unknown function (DUF4638)
This family of proteins is found in eukaryotes. Proteins in this family are typically between 240 and 272 amino acids in length.
Statistics
?
PSSM-Id: 317823
View PSSM: pfam15472
Aligned: 11 rows
Threshold Bit Score: 387.212
Threshold Setting Gi: 351712683
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81873821    1 MTEVVEDTENLMPTERKSFWRSAEERRMSDLTRVLEWLERRQGKKRALQKKkEETKSTEekagk-------knvgaKKKL 73
gi 532065341   1 MSQDQEDPKRAMPTERKSVWRSPEERRMSDLTRVLEWLERRRGKKKLDLQK-SKTKVELpp--------------kAAEK 65
gi 545491243   1 MTEKSEPLKDVTPTERKSMWRTAEERRMSDLTRVLEWLERRQGKKRLIFQ--QKPKGIVlpkvngke--ekktqniQKQQ 76
gi 511839332   1 MMEKSEHLKSAMPTERKSAWRTIEERRMSDLTRVLEWLERRKGKKKQmydlqQKPKGVTspktngke--grkdlniLKQQ 78
gi 410983497   1 MTEPSENLKDSMPTERKSMWRTSEERRMSDLTRVLEWLQRRQGKKKQTFQk---PNWAVppkttgke--ekkgrsiPKKQ 75
gi 803142968   1 MTEKSEDLKNSMPTERKLVWRTAEERRMSDLTRVLEWLERRQGKKKQALQ--NKPKEVIgsaepake--qkktksaLKHQ 76
gi 426382129   1 MSEQPVDLKDLMPTKRKYMWKTAEDRRMSDLTCVLEWLERRQGKKKQAPEk-QKPKVVTvlkrnkkk-eekkgkglMTAR 78
gi 562852305   1 MANILENLKDLMPMERKSTWRTAEERRMSDLTRVLEWLERRKGKKKQISTlkEKPAAAApskaseke--vkkakgiLKAP 78
gi 655884082   1 MSEEPVNPKSLMPTEWKSLWKTAEERRMSDLTRVLEWLERRQGRRKQTPQk-QKSKKETspkasgke--qkkgkgiSRQK 77
gi 564321225   1 MTQEIEDTENLMPTERKSFWRTPEERRMSDLTRVLEWLERRQGKKRALQKkkEEAKGAEekgadk------kttgtKKKP 74
gi 351712683 130 dpkEPKDLKDLMPTERKTVWRTAEERKMSDLTRVLEWLQRRKGKKKQFVQ---KQKVMVmdtpkakmkggkkvkgiWKQQ 206
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81873821   74 e-----KVSRKVTFHKGY-VRPVK-------KKEPTIYHK-RNEIDLKSKRL-SMITANF-RDSNKKSgqsgsrrtsest 137
gi 532065341  66 ------EKKKRKVAKQQAvKKNSV-------KNEEALYRR-MYGSEQMGARL-SVASTAYnKESSRKS------------ 118
gi 545491243  77 ------KGKPQGAFIKKP-SSHVAk------NGDPIMYrr-lySIDPKGPRL-SIIPGNYtKDGPRKS------------ 129
gi 511839332  79 ------KGNRQVAFAKQsrrq------cakkDGDPTVHgkiygSVDPKGNRL-SIIPSSYtRDGPRKSd----------- 134
gi 410983497  76 ------KGNHQAAFSEKT-PEQGTk-----kDKDHVMYqk------lKGKRL-SLVPGSYsRDNPKKS------------ 124
gi 803142968  77 garrksQGNQQVAFSEQI-SSQASgqnssreDETAALYrr-lyRVEAKGKRLsSLTPSTNsNDTPRKS------------ 142
gi 426382129  79 ------GGNRRATETSQQ-ALGKRf------RKDAASYrr-lyGVEQKGKRL-SMVPGSYiKDGPKKS------------ 131
gi 562852305  79 ------GGKPRQELAPGK-ASEQTsr----kDWDAVTYrr-lyGLESKGKRL-SMVPGSYaRDGPRKS------------ 133
gi 655884082  78 ------GGPGK--------TSKQNst----rEESSVATrr-llSVDQKGRHL-S----TFsKDSTRKS------------ 121
gi 564321225  75 d-----KGSRRVTFNKSF-LRPVS-------KKDIISSrk-gsETDTKGKRL-SLISTSYgRDM-KKSgasgsrraseit 138
gi 351712683 207 ------ERVTKSKFQEQT-PGPSSrr----lIGSITLYqrpfgG---EQRHL-SIFAGTYdKDGARRS------------ 259
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81873821  138 DIDIKDVIALETNSRVSAFRRQS-SVDPGIQEG-MFGSRRAGILREWA-NKAPDNNYERKLKSLMEKGMDPKMEISKMLK 214
gi 532065341 119 ELDIKDAIALESTQRPSMFRRQSsIGDPLLQEA-IFSSRRGTLIRDWG-SKAQDASFERKLKTLMDKSTEPKMESLKMLK 196
gi 545491243 130 EINIKDAIALESTQRPLSYRHQS-IADSLLQEPsAFSaRKSTLLRDWVmSRTSDVSYERKLRSLMEKGAEPKAEAVRMLK 208
gi 511839332 135 -LDIKDAIALESIQRSLQYHRQS-VLDPLLQETpVFG-RRSTLLRDLVlGRSTEISYERKLKSLMEKGAEPKVELVRMLK 211
gi 410983497 125 ELDIKDAIVLESTQRSVPYHRQS-IIDPMLQDP-LFStRRSTLLRDWVvGRMPEVSYERKLKSLMEKGAEPKVETVRMLK 202
gi 803142968 143 DLDIKDAVAQESTQRPMPYRRQS-VVEPVLQDT-AFAqRKSTVLREWG-GKMPDASYERKLKSLMDKGTEPKMEMMKMLK 219
gi 426382129 132 DTDIKDAVDPESTQRPNPFHRQSiVLDPMLQEG-TFSsRRATFVRDWS-NKMPDMAYERKLKSLMEKSTEPKMETMRMLK 209
gi 562852305 134 DADAKDIAAMEAAQRANPFRRQSsVLDPILQDT-IFGnRRQTFMREWA-TKTPDSTYERKLKSLMEKGTEPKIETVRMLK 211
gi 655884082 122 DLDIKDNISLESTQRQNPFRRQSsILDPMLQES-IFNnRRMSLIRDWT-SKTPDSTYERKLKSLMEKGNEPKVESMKMLK 199
gi 564321225 139 DIDIKDVIALETNSRVSSFRRQS-TIDPAFQDS-MFGsRRAGLLREWS-SKAPDNNYERKLKSLMEKGLEPKMESAKMLK 215
gi 351712683 260 ELDIKDAIALESTPRPNTLQRQSlFADPSIQDN-AFGsQRMTMMKDWP-DRTLDIAFEPKLKSLMEKGTEPKIENVKMLK 337
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|....
gi 81873821  215 PEEVLSCRYLRLSKNNIKTLIKLCKDAGMDVDIHPHMVEAEIDAKKIFGQRLSV 268
gi 532065341 197 PEEVLSCRYLRLSKNNIRTLLKLCRDAGLSMDIHPHMTESEIDSKKVFGRSSSA 250
gi 545491243 209 PEEVLSCRYLRLSKNNIRTLLKLCKDAGMNVDIHPHMVEGEIDAKKVFAPNPSI 262
gi 511839332 212 PEEVLSCRYLRLSKNNIRTLLKLCKDAGMNVDIHPHMVEGEIDAKKVFNQNPSV 265
gi 410983497 203 PEEVLSCRYLRLSKNNIRTLLKLCKDAGMNVDIHPHMVEGEIDAKKVFAQIPSV 256
gi 803142968 220 PEEVLSCRYLRLSKNNIRTLLKLCKDAGMNVDIHPHMIEGEIDAKKVFNQNISV 273
gi 426382129 210 PEEVLSCRYLRLSKENIRTLLKLCKDAGMNVDIHPHMVEEDIDAKKVFTGIPSV 263
gi 562852305 212 PEEVLSCRYLRLSKNNIRTLIKLCKDAGLNVDIHPHMVEGEIDSKKVFTRMPSI 265
gi 655884082 200 PEEVLSCRYLRLSKNNIRTLLKLCRDAGLNVDIHPHMVEGEIDTRKVFTRTPSI 253
gi 564321225 216 PEEVLSCRYLRLSKNNIKTLIKLCKDAGMDVDIHPHMVEAEIDAKKIFGHRLSV 269
gi 351712683 338 PEEVLSCQYLRLSKNNIRTLFKLCKDVGLNMDIHSHMTETEIDVQKVFPPNRSs 391
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap