Conserved Protein Domain Family
SAP25

?
pfam15476: SAP25 
Histone deacetylase complex subunit SAP25
SAP25 is a family of proteins found in eukaryotes. SAP25 is a core component of the mSin3 co-repressor complex whose subcellular location is regulated by PML. mSin3, the transcriptional co-repressor, is associated with histone deacetylases (HDACs) and is utilized by many DNA-binding transcriptional repressors. SAP25 is a nucleo-cytoplasmic shuttling protein that is actively exported from the nucleus by a CRM1-dependent mechanism. It binds to the PAH1 domain of mSin3A, associates with the mSin3A-HDAC complex in vivo, and represses transcription when tethered to DNA.
Statistics
?
PSSM-Id: 317827
View PSSM: pfam15476
Aligned: 10 rows
Threshold Bit Score: 249.375
Threshold Setting Gi: 625218514
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 586527496   1 MTLLAPWDPNYEAKAGPGLLwGPSCGSGASFSGRTLGHPSfWPLYEaASGRGhrp---laPTIGHQNGK-QVPRDAGFPV 76
gi 625218514  96 MTPLPLWDPIHEANARPQLV-GPSCGSGASLSGRTLCHPS-WPMYD-DWGRV--------PTSGHPEEA-QVSKDTGLPV 163
gi 532085828   1 MTLLSPWDPNYEAKPRPRLVwGSSCGSGASFSGRTLCHPSfWPMYE-VSGRAarp---laPTPGHQNEE-QSPRDAGLPV 75
gi 351710561   1 MTLFSPWDPNFGAKARPQPVwTPSCGPGASFSGRTLCHPSfWPMYE-AWGRGrrh---qaPSLGCQNGQ-QAPRDAGFPV 75
gi 940709668  98 MTLLAPWDPNYEAKAGSQLVwGPSCASGASFSSRTLCHPSfWPLYEaASGRArrp---ltSAAVHQSGE-QAPRDAGFPV 173
gi 355763384   1 MTPLAPWDPKYEAKAGRQPVwGANCSPGASFSGRTLCHPSfWPLYEaASGRGlrp---vaPATGHWNGQ-QAHPDAGFPV 76
gi 942047728   1 MALLAPWDPNYEATAGRRLVwGPSCASGVSFSGRTLYHPSfWPLYQaASCRGlr-----pSLAGHRGEE-QAPRTAGFPV 74
gi 281340856  59 MTMLAPWDPNYKATAGPRLVwGPSCASGASFSGRTLCHPSfWPLYEaASGRElrp---lvPTTGHQNGE-HAPRDAGYPV 134
gi 831241141 105 MTLLAPWDPNYQAKAGPRLVwGASCGSGASFSGRTLCHPSfWPLYEaSSSVGvrprtfrnPGTGPQNGE-WAVQDTGFSV 183
gi 562854324  97 MTLLAPWDPNYHAKAGPRLMwEASCGSGASFSSRTLCHPSfWPLYEaASSRVlrp---laPTTGHQNGDnQAPRDAELPV 173
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 586527496  77 MCCEDVFLSDPLLPCGQRVPLYLSEAPQQVMGSPKLLLPPPIMSPRVCP--TQSPGCSTAWLSGPELIALTGLLQMSQGE 154
gi 625218514 164 TGYEDVFLLDPLLPCGQRVPLYLSKPPQQAVGTRKLLLPPPIMSSSVRP--SSSQACSSTWLSEAEMIALTGLLQMSQGE 241
gi 532085828  76 MCCEDVFLLDPLLPCGQRVPLYLSEPPQQNMSSLKLLLPPPIMSPSVCP--SASQGCSTAWLSGPELIALTGLLQMSQGD 153
gi 351710561  76 MCSEDVFFLDPLLPPGQHVPLYLSEAPQQALGSMKLQLPPPIMSPSVYP--SQPRGCCMAQLSGPELIAITSLLQMSQGE 153
gi 940709668 174 MCCEDVFLSDPLLPPGQRVPLNLPEAPQQVMGSLKLLLPPPIMSPQVCP--TPSPGCCTAWLSGPELIALTGLLQMSQGE 251
gi 355763384  77 MCCEDVFLSDPLLPQGQRVPLYLSKAPQQVMGSLKLLPPPPIMSAWVLPrlSPSRSPSTAWLSGPELIALTGLLQMSQGE 156
gi 942047728  75 MCSEDVFFLDPLLPHGQRVPLYLSEVPQQVMGSLKLLLPRPIMSPWLLP--IPSSGCSTTWLSGPELIALTGLLQMSQGE 152
gi 281340856 135 MCCEDVFLSDPLLPCGQRVPLYLSEASQQVMGSLKLLLPPPIMSPWVLR--TPSPGCSTAWLSGPELIALTGLLQMSQGA 212
gi 831241141 184 MCREDVFLCDPLLPCGQRVPLYLSEAPPQVMGSLKLLLPPPVMSPWVVP--SRSQSCSTAWLSGPELIALTGLLQMSQGE 261
gi 562854324 174 MCHEDIFLSDPLLPCGQRVPLYLSEAPQQVMGSMKLLLPPPVMSPWVHP--TPSRGRSTAWLSGPELIALTGLLQMSQGE 251
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|....*.
gi 586527496 155 PRPSFSGssmAPTPFAG--PPDPIS---NHPRPSGDPSCPHCTDPSLPWTPDTHCP 205
gi 625218514 242 LRPNSLA---SPLTSTScqDPGSAS---EDPGPSGGQSCSGSTDACPTQTPDTHCP 291
gi 532085828 154 PRPSSPP---ASPIPASctAPVPVS---DHPGPSGSQSCSGNTDPPLPQTQDTHCP 203
gi 351710561 154 PRPGSSG---APPSPAG--PLEPIS---DHQSSSGS------TDPSLPRPSDTHCP 195
gi 940709668 252 PRPSSTGslaAPTPPSG--PLDPVS---DHAGPSG----SHGTDPSLPQTPETNCP 298
gi 355763384 157 PRPSSSV---AATPPAG--PPDPTS---DPPSPCGSPSSSQGADPSLPQTPDTHCP 204
gi 942047728 153 PRPSSSG---APGLPSG--SPAPAS---DHPAASGGPGCSHCGEPSLPGTPDVQGP 200
gi 281340856 213 PRPASSG---APTAHAG--PPDPVS---DHPGPSGGPSCSHCTNPSVPRTPDAH-- 258
gi 831241141 262 PRPNSSS---APAAPAG--LPDPISgqpDQSGSSGGPSCSHCTDPCLPWTPDTHCP 312
gi 562854324 252 PRSSLAS---SSIPSAG--TSDPVS---DHPGPSDDQSCFHCTDSSLPWDPDTHCP 299
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap