Conserved Protein Domain Family
CCER1

?
pfam15482: CCER1 
Coiled-coil domain-containing glutamate-rich protein family 1
This is a family of coiled-coil family proteins found in eukaryotes. Proteins in this family are typically between 160 and 397 amino acids in length.
Statistics
?
PSSM-Id: 317833
View PSSM: pfam15482
Aligned: 7 rows
Threshold Bit Score: 281.418
Threshold Setting Gi: 296212524
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74730573    4 TLDTREDPLNLGGGggggcgcgWAHSASLSSWSSCHRRRPGAPAYNRPHRYSPKTEYGPPRKQPKQQHGPGFWFQPPv-- 81
gi 514473239   4 TLFQKEDPLNLGGG--------WSSSAHLGTWSSCHRRRRGAPVHKQRYSHGSKPRYEPPRKKSKQQHASGPWFQPPrrp 75
gi 311256719   4 TLDTREDPLNLGGG--------WSSSAPLRTWSSCHRRRRGAPIYKRRHHYGPKAEYEPPWKQQKQQHGPGPWFHPPrrp 75
gi 354483475   4 TVNEREDPLNLGGGg-------WASSIPLRTWSSYHRRQRGSQMSKRRYRNGPKAEYEATRKQPKQQHSPGPWFQPPrrp 76
gi 296212524   4 TFNMKEDPVNLGGG--------GAHSSSLHSWSSCYRRRRGAPVYNRWHRYGPKTEYGPPRKQPKQQHSPGFWFQSPv-- 73
gi 444720710   4 TLDKREDPLNLGGG--------WASSSPLRPWRSCHRKRRGAPIYKRRQGYGPKVEYEPPRKQPKYQYGSGPWFQPPqpp 75
gi 987937111   4 TLHKREAPPNLGGG--------WAASAPFRSWSSCHRRRRGVPIYKRRQHYGPKAEYEPQRKQPKPRYGPGPWFQPPpsp 75
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74730573   82 ----CSNWGCWGGPWRPPPPGFWKFPCPVQVFRVYGLHPLCF-CCCSCWSGSWNPGWVKPPGRKKRW---GRRGRgLRHH 153
gi 514473239  76 --cwYPNWGRCGWPWRPPPAGFQKPPCPVEMMRVYGLHPLCL-CCCSCWCAPWNPGWARPPGRKKRW---GRRGR-LRRP 148
gi 311256719  76 swavYSNWGRWGGPWRPPPARFRKPPGRVQVIRVYGLHPLCL-CCCSCWRGPWNPGWARPPGRKKRW---GRRGRgLRRH 151
gi 354483475  77 ywavYSNWGRCGGHWHPPLMAFQSPLCPAQMIRAYGLLPLCLcCCCSCWCWPCNPGWERPQGRKKRW---GRRGRgLRRQ 153
gi 296212524  74 ----CSNWGCWGGPWRPPPPVFWRPPGRVQVISVYGLHPLCF-CCCSCWSGSWNPGWTRSPGKKKRWgrrGRRGRgPRHH 148
gi 444720710  76 awalNFNWGSWCAPWHPPPTGFRKPPGR--VVRMYGLHPFCL-CCCSCWGGPWNPGWARPPGRKKRW---GRRGRgLRRQ 149
gi 987937111  76 ywsmYSNWGCWGGPWCPPPMGHRKPPSPGLVARMYGLHPVCL-CCCFCWRGPWNPGWGRAPVRKKR-----------RRQ 143
                        170       180       190       200       210       220
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 74730573  154 PRHSYPRSPPADVSTLPRPVKLYEWREPGMRAPPNTTQFIMNQIYEDMRQQEKVERQQEALRAQKA 219
gi 514473239 149 PRRSCPRGPPVDLSMLLRPVNLYGWRAPGMRAPRNTTQFIMNQIYQDMRQQEKLERQQRAQKAQQA 214
gi 311256719 152 SRRSFPRRPPVDLSTLLRPVNLYGWRAPGMRAPKNTTQFIMNQIYEDMRQQEKLERQQEALRAQQA 217
gi 354483475 154 PRGSFPRNPPIDLSKLLRPVNLYGWRAPGMRAPRNTTQFIMNQVYEDMRQQEKLERQQAALRAQQA 219
gi 296212524 149 PRRSSSRSPPGDLSMPLRPASPYEWRAPGLRAPRNTTQFIMDQIYEDMRQQKELERQQEAKRVQQA 214
gi 444720710 150 PRGSSSRSPPVDLSTLLRPVNLYGWRAPGMQAPPNTTQFIMDQIYQDMQQQEELERQQRAQAGAQa 215
gi 987937111 144 PSRPVPRSPSAEVSPLLQPVDLYGWRAPGLQAPRNTTQFIMDQIYEDMRQQEKLERQQEALRAQQA 209
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap