Conserved Protein Domain Family
DUF4644

?
pfam15486: DUF4644 
Domain of unknown function (DUF4644)
This family of proteins is found in eukaryotes. Proteins in this family are typically between 143 and 191 amino acids in length.
Statistics
?
PSSM-Id: 317837
View PSSM: pfam15486
Aligned: 3 rows
Threshold Bit Score: 285.413
Threshold Setting Gi: 291413150
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291413150  16 DAVGRAQGHLSHLDTPLNIYEGGLGNQQQQCPVAQGSKPKNFRLRHLRGLALYLPGHMQPAGQCKSHWLGQLMTGGCLPQ 95
gi 884940727  16 DAVSWAGGHPSHPDTPPNIYEGGLGTQQEQCPGVQGSKPKNFRLRHLRSLALYLPGHMQPTSQGESHFQDQLLVRDCLPQ 95
gi 831227379  84 dAVSWAQGHPSHPDTPPNIYEGGLGTQQQQCPSAQGSKPKNFRLRHLRGLALYLPGHMQPAGQCESHWLGRLMAGGCLPQ 163
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 291413150  96 PEGSAWLLVLPQGPLGPGNSRCSALLEAQVPGDSLRSTASSSSSDQTQDTPSQPGAPEGLGVRPkR 161
gi 884940727  96 PEDSAWPLDLPQGTLGPGNSTCSAFLEAQLPRDNLGNTASSSSMDPAKGPLPQPEPHEGLGLRP-K 160
gi 831227379 164 PEGTPWSLDLPQGTLGPGNSHCSALLEAQLPRDSLGNTASSSSMDPAKGAPSQPSPPEGLGLRPkR 229
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap