Conserved Protein Domain Family
DUF4645

?
pfam15488: DUF4645 
Domain of unknown function (DUF4645)
This family of proteins is found in eukaryotes. Proteins in this family are typically between 200 and 298 amino acids in length.
Statistics
?
PSSM-Id: 317839
View PSSM: pfam15488
Aligned: 8 rows
Threshold Bit Score: 406.543
Threshold Setting Gi: 189041691
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189041691   1 MACTENG-LAGHSHSPIIVPVDKNRSKETCH-NVQLRSlssmLKDDeddADVWTRPPVSLRPPFNVP------------- 65
gi 189041689   1 MACIENV-LGGHAPSPTAVAAAENGNREPRP-SLPFQC----PKDD---AGSWGHPGVPLRPPFKVLsdlarerlerpse 71
gi 914900272   8 dtfkEMG-FGGYGPSVAVVAVNKNGNKDLSP-DGPLQClnsmQKNDedgAENWGCPRIPLRPPLNMLtdlagdqlkgpde 85
gi 558099417   1 MACVKNV-LEGHASSPIAMTADENVKPRPDP-NKLLQCsstmLKEE---AEAWGKPRRPLRPPLYVPpeltrgqlegpre 75
gi 350595906   1 MACTENV-LGAHASSATAVAAEEHADREPRP-AVQLQCpssaLQGN---SESWGHPRLPLRPPFGVLtdlareqlerpse 75
gi 545559285   1 MACIENV-LGGHAPSPSGVVANECGIREPHPdDVSLQCssslPKDD---VEPWGHHRVLLRPPLNVLtdlareqlerpse 76
gi 655877802   1 MACIENVsLGRHAPSPIVGTMDKNGNQDLHQ-DMPKEClssmLRED---VEPWGHTHVPLRSSFNVLtdltrqqlerpse 76
gi 355757681   1 MACIENV-LGGHAPSPLVVAMDKNGNQELHL-DMPLQClsskPEDD---TEPWGLPQVLLRPSVNVLtdlaseqpecpse 75
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189041691  66 RTGARIP-QNPRAPRHPLTLTPAIEEESLATAEINSSEGLESQSQKGHDSI-NMSQEFSGSPMALMIGGPRVGSRVLERS 143
gi 189041689  72 RTGSCIPvDGWRALKPPYGPPPAVAEEPLATGEVNSSEGPAGWRQSGQDSInNVSQEFSGSPPALMVGGTKVSNGGTERG 151
gi 914900272  86 RTGSSIP-DLSRAVRQPCGLPPAVVEESLATEGVNSSEGLASWRLKGHDSI-NVSQKVSGSSPALMVGGTRVSSVTSERG 163
gi 558099417  76 RRGSCIPvDTSRALQCPYWPPPAAAKGSLATAEINSSVGLAGWGQMGQDSI-NVSQKFPGCSPSVMIEGTRVSNEGAEGG 154
gi 350595906  76 RTESCIPvNCSRALNPLYRLPPAAAEEALATAEVNSSEGLAGQRQRGQDSI-HVSQEFSGGPPVLMVGGTRVSNGSTERG 154
gi 545559285  77 TAGACIPvDSSRAHKHPYGPPPAVAEESLATAEVNSSEGLAGWRLRGQDSI-NVSQEFSGSPPALMIGGARVSSGGTERG 155
gi 655877802  77 RTGSCIPvVSSRALRQPYGPPPAVAEESLATAEINSSEGLAGRRQKGQDSI-NMSQEVSGGPPALMVGGTRVSHGGTERG 155
gi 355757681  76 RTGSCIPvHSLRALRHPYGPPPAVAEESLATAEVNSSDALAGWRQEGQDAI-NVSWEVSGSPPALIVGGTKVNNEGTERG 154
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189041691 144 GNNSKPYIPVPRSQGFFPPRGSQSRGPPYIPTLRSGIMMEVTPGNARMAN-RGNMAHVSFPLGSPRHPMDNWQQspSLPL 222
gi 189041689 152 GSNAGLYVALPRGQGFFPSRGPQVRGPTHISTLRSGIMMELPPGSTRVTG-KERLARVSFPLGGPRHPVKNWPR--PMPL 228
gi 914900272 164 GNTAKSVPTLPRGQGFFPLRGPQVRGPSFVPTLRSGIMMEVPLGNTRMACnNGRLAHVSFPPASPRHPG-------PMPM 236
gi 558099417 155 VNKAKFHSVLQQGQGFFPPRGPLIKDPPPIPTVGSGIKMEEPPVNVKMAG-NEKMPQAAFPLGGPWNPMNNCPR--PIIM 231
gi 350595906 155 GSSARLYVALPRGQGFLPSRGPQVRGPPHIPTLRSGIMMEVPQGSKRMTS-KESLAQVSFPPGGPRHSVENWLR--PVPL 231
gi 545559285 156 GNNARLYMALPRGQGFFPPRGSQIRAPPHIPTIRSGVMMELPLGNTRMAS-KERLAHVSFPQGGPRHPVENWPR--SLPL 232
gi 655877802 156 GNNARFYSTLPRGKGFFQPRIPQVRGPPQIPTLRSGIVMEVPPGNPRMAC-QRRLAHVSFPPGRARHPMDRWPR--PIPL 232
gi 355757681 155 SNNARLYVALPRGKGFCSPRGPQVRGPSHITTLRSGIVMEVPPRNTRIAC-RGKLAHVSFPLGDPCHPMHNWPR--PIPL 231
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 189041691 223 SPSITGLP-CSSAHCFLPPQ-APAFNPFPVMPTAFASPLRFGPPLLPYVFHYNTGAMYPPPYLN 284
gi 189041689 229 ASSTTGLGsRTTAHCFIPPR-PPSFNPFLAMPMAFAPPPIFGPPLPSCFADFPSWGMPAPASSN 291
gi 914900272 237 SSSVPGLP-CSTAHCFIPAL-PPSFNPFFIKPIAFAPPPVFGPPLSPYFAHLHSGRMPFPASFN 298
gi 558099417 232 PASITHVGwFTNGPCFIPSG-SPSSYPFLNLPFPPPPMY--RPPLLPYFGNFPSSELPPSPFLN 292
gi 350595906 232 SSSTPGVPsCATAHCFIPPR-PRSFNPFLAMPIAFAPPPLFGPLMPSYFANFPSWGMPAPACSN 294
gi 545559285 233 SSSTPGLPsRPTAHCFISPRpPPSFSPFLAMPIAFAPPPIFGPPLPSYFANFPSWGMPAPAPSN 296
gi 655877802 233 SSSTPGLPpCSTAHCFISPQ-PPSFNPFLAMPIAFAPPPIFAPPLPSYFAHFPSGGMLV-ASSS 294
gi 355757681 232 SSSTPGLPpCSAAHCFIPPR-PPIFNPFIAMLLPFAPPPIFHPPLPSYFVHFHSGGMPAPASPN 294
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap