Conserved Protein Domain Family
CTC1

?
pfam15489: CTC1 
CST, telomere maintenance, complex subunit CTC1
CTC1 is one of the three components of the CST complex that assists Shelterin to protect the ends of telomeres from attack by DNA-repair mechanisms. Mutations in human CTC1 have been recognized as contributing to cerebroretinal microangiopathy.
Statistics
?
PSSM-Id: 317840
View PSSM: pfam15489
Aligned: 11 rows
Threshold Bit Score: 1620.99
Threshold Setting Gi: 514725854
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 292495002   61 LPLSYSFVSVQDLKTHQRLPCCSHLSWSSSAYQAWAQEAG---PNGNPLPREQLLLLGTLTDLSADLEQECRNGSLYVRD 137
gi 291405081   61 LPLSYSFVSAQDLRTHQHHPCCSHLSWSSSDYQAWAKKAE---PNGTPLPREQLILLGTLTDSLGDSEQDCRNGSLYVKD 137
gi 884896251   60 LPLNYSFASVQKLRSH-HQPCCSHLSWSSSAYEAWAQEAE---SSGNPLPQEQLLLLGTLTDLSQDSEQESRDGSLFVRD 135
gi 297486784   61 LPLSYSFVSVKDLRTHQRLPCCSHLSWSSTVYQAWAQEAG---PRGVPLPRERLLLLGTLTDLSGNLEQECRNGSLYIRD 137
gi 281343206   50 LPLSYSFVSVQDLKTHQNLPCCSHLSWSSSAYEAWAQEAG---PNGTPLPREQLLLLGTLTDLSGDLEQESRKGDLYVKD 126
gi 731501747   81 LPLSYSFVSVQDLRTYQRLPCCSHLSWSSSAYQAWAQEAG---PGGAPLPRERLLLLGTLTDLSGDLEQECKNGSLYVRD 157
gi 532094454   61 LPLSYSFVSVQNLRTYQHLPCCSHLSWSSIAYQTWAPEAR---PNGVPLPRERLLLVGTLTDLSE--EQGCRNGSLYVRD 135
gi 514725854    7 fsffsSFISISDLKSQQCMPCCSHLTWSTKEFKEWAHQGKgalPTHSSLPRAYLILVGYLTDGRQEDKEKLVDGCLYVKD 86
gi 611994258   61 LPLSYSFVSVQELRTHQHLPCCSHLAWSSTEYQTWANKAG---LDRVPLPRERLILVGTLTDLPGDLDPELRDGSLYVKD 137
gi 157822211   61 LPLSYSFVSVQNLKTNQHLPCCSHLSWSDNAYQAWTRGAG---PGGSVLPREQLLLLGTLVDLLGDLEQESRSGGLYVRD 137
gi 537145488   64 VPLNYSFVSVQNLKTQQRLPCCSYLSWSSDAYQAWSQGAE---PRGNILPRQQLLLLGTLTDLSGDLEPECRNGSLYVRD 140
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 292495002  138 NTGVLSCELIDLDLSWLGHLFLFPRWSYLPPARWNSSG-EGHLELWDAPVPV--FPLTISPGPVTPIPVLYPESASCLLR 214
gi 291405081  138 NTGVLGCELIDLDLSWLGHLFLFPSWSYLPPAKWNFSE-EGHLELWATPVPV--FPLTISPDPLVPIPVLYPETASRLLT 214
gi 884896251  136 NTGILGCELLGLDLSWLGHLFLFPSWSYLPPAKWDSSG-EGHLELWDAPVPV--FPLSVSPEPLTPLPVLYPRMASQVLG 212
gi 297486784  138 NTGALDCELIDLDLSWLGHLFLFPSWSYLP-SLMKSPG-EGHVELWGTPVPV--FPLTISPGPLTPIPVVYPEMASRLLR 213
gi 281343206  127 NTGVLTCELIDLDLSWLGHLFLFPNWSYLPPARWNSSG-EGHLELLSAPVPV--CPSTTSPGPPTPLPVLYPETASRLLR 203
gi 731501747  158 NTGILGCELIDLDLSWLGHLFLFPSWSYLPPARWNSSG-EGHLELWGAPMPV--FPLTVSPGPTTPIPVVYPEMASRLLR 234
gi 532094454  136 NTGSLGCELIDLDLSWLGHLFLFPSWSYLPPARWNSSK-EGHLELWEAPVPV--FPLTISPDPLTPIPVLYPQIASCLLR 212
gi 514725854   87 NTGIIPCELLHFELEWLESLFLFPSWAYVPQADQGA---AGYLEILLDPIPVnlLPKKVPES----TAVIYPASAEPLLA 159
gi 611994258  138 NSGTLDCELLDLNLSWLGHLFLFPSWSYIPSAWQRSLSgSGHLELLCPPVPV--LPLGFNHDPETPIRVLYPEIAFHLLQ 215
gi 157822211  138 NTGTLDCELIDLDLSWLGHLFLFPSWSYLPPAKRNSLG-AGHLELWGTPVPV--FPLTVSPGPLTPIPVLYPEKASYLLR 214
gi 537145488  141 NTGALDCELIDLDLSWLGHLFLFPSWSYLPPAKKNSFG-EGHLELWGTPVPV--LPLAVSPGPLTPIPVLYPEKASYLLR 217
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 292495002  215 LrNKL-RGVQRNLAGSLVRLSALVKSKQKAYFILSLGR-SHP----AVTHVSIIVQVPAQLVWHRALRPGTAYVLTELRV 288
gi 291405081  215 H-GKP-RVTQPNLAGNLVGLSALVRSQKKAYFILSLGG-SSP----AVSRVPVIVQIPGQLVWHRALQPDKAYVLTGVRA 287
gi 884896251  213 HrSKL-RNAQSNLAGKLVRLSPLVRSQQKTYFILSLGE-PTSaagqAVGQVPIIVQVPAQLVWHRALRPGEDYVLTELRV 290
gi 297486784  214 YrSKH-RNVQPNLAGNLIRFSALVKSQKKAYFVLFLGG-SSP----AGTQVSVIVQVPAQLVWHRALCPGRAYVLMELRV 287
gi 281343206  204 HrGKL-RGVQPNLAGKLVRVSALVRSQKKAHFVLSLGSgSSP----AGSHVSVVVQIPAQLVWHRALWAGRSYVLTALRV 278
gi 731501747  235 HrSKF-RFVHPNLAGKLVRLSALVNSHRKTYFVLSLGS-SSP----AVSHVSIVVQVPAQLVWHHALWPGRSYVLTELRV 308
gi 532094454  213 HrSKL-RGEKQNLAGKLIRLSALVKSKKKAYFILSLGE-LSPtvsqAINHVSIIVQIPAQLVWHRALWPGKAYVLTQLRV 290
gi 514725854  160 SrIPCkKRPKLNVAGELARRSPLLCIHRKTFFFLFLKC-FT-----SAVSVPVMVQTPSQLAWHHTLQLGRRYTITGLSM 233
gi 611994258  216 HrSKF-RRRQLHLAGQLVRLSTLVKTHGKTYFILSLGG-PSS----ATTPVPIIVQIPSQLVWHHALRPGHSYVLTNLQI 289
gi 157822211  215 YrKKC-KIKELNLAGKLVHLSALMVTQNKRYFIMTLGE-LAQ----AGSQVSVIVQIPAQMVWHRVLRPGRAYVLTKLRI 288
gi 537145488  218 YrKKH-KLKEPNLAGKLVRVSALVTMKNQRYFIATLGE-LTEadghAGGQVSIIVRIPAQMMWHRVLRPGKAYVLTKLRV 295
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 292495002  289 SKIRGQRQHVWMTSQSSRLLLLKPECVQ----------ELELEleGPLLEADPKPLPMPSNSEDKKD-----PE-SLVRY 352
gi 291405081  288 SKIRGYRDRVWTTSPSSRLMLLKPECVR----------ELELE--ESLLKADPTPLTVPSSSQDSSSqdtgrQK-DLDRD 354
gi 884896251  291 SRIHGHRYRVWTTTPASNLVLLNPECVRelelglelegALE---------AEPKPFPAPSNSQAGKG-----QK-GLSQD 355
gi 297486784  288 SKLPGHRYRVWMTSTSSQLLPLKPECVR----------ELELElaGVPLEADPQSLPRPSSPQDKKRp---gPD-CLVRD 353
gi 281343206  279 VRIRGHCYRVWTTSPSSHLLPLKPECVR----------ELELEldGPLLEAD----PAPSSSQDGDR-----EP-ALIRH 338
gi 731501747  309 SGICGHRYRVWTTSPSSQLLPLKPECVR----------ELELEleGPVLEADPKLLPVPISSQDWTG-----KK-GLIRN 372
gi 532094454  291 SRIPGYHYCVWMTSSSSHLMLLEPGRVQ----------ELELE--GPFLEADSKSHPTSSNFQDKKG-----PK-GLMRD 352
gi 514725854  234 SGLKKSGQRMFVTGVSSCLLPYSAEHVK----------EQSLDsaWQGESSVPASLGTTEQLSDSIElrveeERlGSTKK 303
gi 611994258  290 SVIRGFSNRIWATGPSSHLMPLEPEHVQ----------EFNVE--ELILETIPNLLPVPSSSQE--------HH-NSIRE 348
gi 157822211  289 TKTRGHRSCIWTTIPSSTLMPLRPGYVQ----------ELELD--VAFADAGHKPLPEPTSSRDSRG-----QE-GLVRG 350
gi 537145488  296 IKTRGHNYYIWTTVPSSDLIPLRPGYVR----------ELELD--ISFLEADLTPLPQPTNSKDSSG-----Q--GLVRS 356
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 292495002  353 SRLLSYSGAVTGVLNEPAGLYELDGQLGLCLAYQQFRGLRRVMRPGVCLQLQDVHLLQSVGGGTRRPVLAPCLRGAVLLQ 432
gi 291405081  355 STLLHYGGTVTGVVNEPAGLYELDGQLGLCLAYQQFHSLRRVMRPGVSLKLLDVHLLQSVGGGTKRPVLATCCRGAVLLQ 434
gi 884896251  356 SLLLHYKGTVTGVLNEPAGLYELDRQLELCLAYQQFQGLRRVMRPGVSLELRDVHLLQLLGGGTERPVLAPCLHGAVLLR 435
gi 297486784  354 SILLSYTGMVTDTLNQPAGLYELDRKLELCLAYQQFRGLRRVVRPGVRLELQDVHLLQSVGGGTRRPILAPCLRGAVLLR 433
gi 281343206  339 STLLSYTGKVTGVLSQPAGLYEVDGQLALCLAYQQFHSLRKVVRPGVSLELQDVHLLQSVGGGTRRPVLAPCLHGAILLR 418
gi 731501747  373 SRLLSYTGMVTSVLNEPAGLYELDGQLGLCLAYQQFHSFRRVVRPGACLELQDVHLLQSVGGGTKRPVLAPCLGGAVQVR 452
gi 532094454  353 SRLLNYMGTVTDVLNEPAGLYELDGQLGLCLAYQQFRALRRVIRPGVRLELQDVHLLQSVGGGTTRPVLASCLRGAVLLR 432
gi 514725854  304 SKMISYVGTVTKVLNAQAGLYELDNKVCLCLAYQQLLNSARGLRPGACVELIDVHLIQKPVVSSPSIVLGACLNSTVTLK 383
gi 611994258  349 VRMLSYKGTVTKVLNDSASLYELDGQLCLCLAYQQLPNNGRAIRPGAQLELQDVHFFQSVGG---VPTLAPCLRGAVLLQ 425
gi 157822211  351 SKVLHYLGTVTDVLNESASLYILDGQLILCLAYQKIHGLRRVIRPGVCLELRDVHLLQGLGGGTTKPVLALCLHGTVRLQ 430
gi 537145488  357 SKVLHYVGTVTDVLNESASLYMLDRQLILCLAYQQIHGLRRVIRPGVRLELRDVHLLQSVGGGTTKPVLALCLHGTVLLQ 436
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 292495002  433 SFSRQKPGAHSSRQAYGASLYEQLVWERQLGLPLYLWATKALEELACK-LCPHVLRHHQFLQHSSPGSPSLGLQLLAPTL 511
gi 291405081  435 SFSCQKPGNQCSHQAHGASLYEHLIWERHLGLPLYLWAAKALEELACK-LCPHMLRHYQFLQHSSPGSPSLGLQLLAPTL 513
gi 884896251  436 AFSCQKPGAQSSHQVHGAPLYEQLIWKHQLGLPLYLWASRALVELACK-LCPHMLRHGQFLQHSSPAHPSLGLQLLAPAL 514
gi 297486784  434 GFSHQVPETQFSHQVPQASLYEQLVWEHQLGLPIYLWATKALEDLACK-LCPHVLRYHQFLKYSSPGDPSLGLQILAPIL 512
gi 281343206  419 GFSCQKPENQSFYQAQGASLFEQLIWERQLGLPLYLWATRALEELACK-LCPHMLRHHQLLQHSSPGNPSPGLQLLAPVL 497
gi 731501747  453 GFSRQKPKTQSSHQAHGASLYEQLVWEHQLGLPLYLWASKALEELACK-LCPHVLRHHQFLQHSRPGNPGLGLQLLAPTL 531
gi 532094454  433 GFSCQKPGRQSSHQAHGAFLYEQLVWEWQLGLPLYLWAVKALEELACK-LCPHLLRHKQFLQHSSPRNPSLGLQLLAPTL 511
gi 514725854  384 SFSRLSTPYQPP--ATSGNLYLQLLFRYNLDMPCYLWLVILLETFEERfSC--FFGHQQLLRSSVHQNPGAAEKFLAPLL 459
gi 611994258  426 GFSQQESLKQSPHSFCGVVLHLRLLLERHMGLPLYLWTARALEEITSK-LCPHLLKHHQLLKSSASGTAGLGELLLAPTL 504
gi 157822211  431 GFSCLKPQNLPSYKVHGASLYEQLVWKCQLGLPLYLWATKALEELVYK-LCPHVLRCQQFLKHSSPGKPSLGLQLLAPSW 509
gi 537145488  437 SFSCLKPETLPSYKVHGASLYEQLVWERQLGLPLYLWATKTLNELSRK-LCPYVLRYHQFLKHSSPGNPSLALQLLAPSW 515
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 292495002  512 DLLAPPGSPVRNAHNEILEEPHHCPLQKYTRLQTPSSFPTLATLKEEGQRKAWASFDPKALLPLPEASYLPSCQLNRRLA 591
gi 291405081  514 DVLAPPPSTGRKVFSEILTEPHHCPLQKYARLQTPYCFPTLASLREEAERRAWASFEPKALLPLPEAAHLTSCQLNHRLA 593
gi 884896251  515 NDLAPPGSARRNVHSEILEEPHRCPLQKYVRLQTPCSFPTLDALAAEGQQKAWASFDPKALLPLPEAAYLTSCQLNQRLA 594
gi 297486784  513 EVLIPPGCPGRNTHSEILEEPHHCPLQKYTQLQTPCFFPTLAFLKEEAKRRAWASFDPKTLLPLPEASHLPSWQLNQRLA 592
gi 281343206  498 DVLAPPGSTRRNAHKEILEEPHHCPLQKYTRLQTPCSFPTLATLKEEGRCRAWAAFDPKTLLPLPESSHLTSCQLNQRVS 577
gi 731501747  532 DILALPDSPIRNAQKEILEEPHHCPLQKYIRLQTPCSFPTLATLKEEGQSRAWASFDPKALLPLPEASHLPSCQLNHRLA 611
gi 532094454  512 DALAPSSRSIRNAHTEILEEPHHCPLQKYARLQIPYSFPALDTLEKEGRCRAWASFDPKVLLPLPEAAHLSTCQLNNRLA 591
gi 514725854  460 QAVVAGREETRDICNEILAKTHQCPLRKYSTLDPPCQIPSLSALRGLAEQKSWEGFCPSQLLSPVEAQHMGTQELNRRLA 539
gi 611994258  505 DVLAPPGRSIRNVYQEIVEDPHHCPLQEYSLLQPPCSFPTLAALKEDAQCRAWATFDPMTLLPLTEVNHLPSYVLNARLA 584
gi 157822211  510 DVLIPPGSPIRHAHSEILEEPHNCPLQKYTPLQTPYTFPTILALAEEGQHRAWATFDPRALLPFPEAFHLTSCQLNRRLA 589
gi 537145488  516 DVLISPVSPIRHAHSEILEEPHNCPHQKYTQLQTPYSFPTLLDLAEEGQRRAWATFDPKALLPLPEAAHMTSCQVNRHLA 595
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 292495002  592 WSWLCLLPSAFCPAQVLLGVLVASSHK---GCLQLRDQSGSLPCLLLAKHSQPLSDPRL--IGCLVRAERFQLIVERDVR 666
gi 291405081  594 WSWLCLLPSAFHPAQVLLGVLVASSHK---GYLQLRDQSGSLPCLLLAENQQPLMDPQL--IGCLVRVEKFQLVIERNVR 668
gi 884896251  595 WSWFCIRPSAFCPAQVLVGVLVASSRK---GYLCLRDQSGALPCLLLAQDSQPVTDSRL--IGCLVRAERFQLVVERNVK 669
gi 297486784  593 WSWQCLLPSAFRPAPVLLGILVPSSRK---GCLQLRDQSGSLSCLLLAQPLQPLTDPRL--IGCLVKADRFQLVIERNVR 667
gi 281343206  578 WSWLSLLPATSHPAQILIGVLAASSHK---GCLQLRDKSGSLPCLILAKHCQPITDSRF--IGCLVRTEKFQLVIERNVR 652
gi 731501747  612 WSWLRLLPSAFHPAQVLVGVLVASSQKvvcNC----GPKCSLPCLPLTKHsDPCQKEKFlpLGCLVRTERFQLIVERDVR 687
gi 532094454  592 WSWLCLLPSAFHPAKALVGVLVASSHK---GCLQLRDRSGSLSCVLLAKHSQPLTDPQL--VGCLIRTEKFQLVVERDVR 666
gi 514725854  540 WSYCTLWAGSFQPRAIVQGVLRVSSRS---SLLQLQDNSSSLPCVISHRDGSPFANTAL--VGSLLQVENYQLVVERFIQ 614
gi 611994258  585 WSWVCLSPTFFQPPPVLLGVLVASSHR---GWLQLRDQSGSLPCLPLPEPSQAFIDPRL--IGSLVRLERFQLVVEREVK 659
gi 157822211  590 WSWLCLPSSMFQPAPVLLGVLVASSHK---GCLQLRDVRGSLPCIPLPESSQPLIDPKL--IGCLVRVEKFQLVVEREVR 664
gi 537145488  596 WSWLCLPSCVFQPAQVLLGVLVASSQK---GCLQLRDRSYSLPCMPLSETSQPITDPKL--IGCLVRVEKFQLVIEREVR 670
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 292495002  667 SSFPSWKELSMPGFIQKQQARVYVQFFLADALILPVPRPCLHSATps-tPQ---------------------------TD 718
gi 291405081  669 SAFPSWKELSEADFIRKRQARVYAQFSLTDALILPVPRAILYSAT----PP---------------------------TE 717
gi 884896251  670 SNFPSWKELGVADFIQKQKARVYIQIFLADCLILPVPRSAPHSVTspasAQ---------------------------ME 722
gi 297486784  668 SSFPSWKELSTTDFIQKKQARVYVQFLLADALILSVPRPVLHSATsstpPR---------------------------TE 720
gi 281343206  653 SNFPSYKELNMTGFIQKQQARVYIQFFLADALILPVPRPLLHSATsl-tPQ---------------------------AE 704
gi 731501747  688 SNFPSWRELSMAGFIQKQQARVYVQFFLDGALILSVPRPFLRSATrsghSQ---------------------------AE 740
gi 532094454  667 SNFPSWKELGMTGFIQKQQSRVYVQFFLEDALILPVPRSFHHSSSp---PQ---------------------------TE 716
gi 514725854  615 SDFPSWEQLANPQYVREKKSSVYVQFYFEDIQVLRAAEGQIQKERrgenstslrkrnngtsaseletpeakilkledpkp 694
gi 611994258  660 STFPSWKELGIPGFIQERRTNIYVLFSLADALILPIHSPSSHHPSprgpPQ---------------------------AK 712
gi 157822211  665 SSFPSWEELGMASLIQKKQARVYVQFYLADALILPVPRPTVGLEP----SE---------------------------TA 713
gi 537145488  671 SSFPSWKELDIKGFIQKKQARVYVQFFLADALILPVPRATFDSES----PQ---------------------------RD 719
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 292495002  719 P-TGPEGPHLGQSR---------LFLLCHKEALMKRNFCVPPGASPEVPKPALSFYVLGSWLGGTQRKEGTGWGLPEPQG 788
gi 291405081  718 PhCCPEGPHEGQSR---------LFLVSHKEALMKRNFCAPPGTSSEAPTPTFSFCVSGSWLGGTQRKEGTGWGPPEPQG 788
gi 884896251  723 P-SCLEQPPEGQSR---------LFVLSHKETLMKLNFCASSRASTEVLKPTFSFQVSGVWLGGTQRKMGTGWGPPEPLK 792
gi 297486784  721 P-SPPEGPHIEQSR---------LFLLSHKEALMKRNFSVPPSASSEVPQPTLSFHVLGRWLGGTQRKEGTGWGPPEPKE 790
gi 281343206  705 P-TLPDGPHVEQSR---------LFLLSHKEALMKRNFCVPPGANPEVPKPILSFCVSGSWLGGTQRKDGTAWGPPEPKG 774
gi 731501747  741 P-THPDGLHMGQSR---------LFLLYHKEALIKRNFCAPPGASLEAPQPTLSFHVSGSWLGGTQRKEGTGWGPLEPQG 810
gi 532094454  717 S-TGVEGPHIGQSR---------LFLLSHKEALMKRNFCASSGATSGLPKPTLSFHVSGCWLGGTQRKEGTGWGPPEPLT 786
gi 514725854  695 dpdrEERCQKGPSStgrtscvsqLFLVTQKEGLMLRNYQLPREGGGEGHELQNSFQATVLWLGRPLL-----WNHPREIG 769
gi 611994258  713 F-PRLEGPPKGQSR---------LLLLSHKECLMKRNYQSSQGADPLPPKPTLSFHASGTWLGGIQRKEGNDWGLPEPLG 782
gi 157822211  714 S-SCPEGPQVGQSR---------LFLLFYKEALMKRNFCLLPGDSSRPAEPTLSFRVSGTWLCGTQKREGSGWSPPESLA 783
gi 537145488  720 S-SCPEGPHVGQSR---------LFLVSHKEALMKRNFCVLPGASSQPPKPTLSFCVSGTWLCGTQRKEGSGWGPPESLG 789
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 292495002  789 NDDNDQ-------------KVHLIFFGSSVRWFEFLHPGQVYRLIAPGPATPMLFEKDGSSCISRRPLELAGCASCLTVQ 855
gi 291405081  789 DENEDQ-------------KVFLIFFGSSVRWFAFLHPGQVYRLVAPGPPTPAVFEADGSACRSQRPLELAGCVSCLTVQ 855
gi 884896251  793 EENRDQ-------------KVLLLFRGSSVRWFAFLHPGQVYRLVAP-PSTPMLFEAEGASCVSRRPLELAAGGSCLTVQ 858
gi 297486784  791 DENSDQ-------------KVLLLFLGSSVRWFEFLHPGHVYRLVASGPPTLMLFEEGGSSCVSQHPLELAGCASCLTVQ 857
gi 281343206  775 DENKDQ-------------KVLLVFRGSSVRWFELLHPGYVYRLVAPGPPTPLLFEEGGPSCIPQRALELAGCASCLTVQ 841
gi 731501747  811 DEKKNQ-------------KVLLIFLGSSVRWFEFLHPGQVYRLVAPGPLTPALFKEGGSSCISQRPLELAGYASCLTVQ 877
gi 532094454  787 DESKDQ-------------KVLLIFLGSSVRWFEFLHPGQVYRFVAPGPATPKLFEVEGSSCTSQRPLELAGCVSCLTVQ 853
gi 514725854  770 NLPALEeiscdgeegvkqqEALLLFMGKSLRWFPFLHLDGLYRFIVPRCSDLEVFDKLRFPAVPAEFWGRSSCPLCLPVQ 849
gi 611994258  783 DESQDQ-------------KVFLLFFGQSVRWFEFLHPGQQYRLIIHDSTFPGLLKEGDSSPLSQRILESTGFTSCLIVQ 849
gi 157822211  784 AENKDQ-------------KVFFIFLGSSVQWFPFLYPNQVYRLVAP-DSTPALFETNHSSGTPHRPLELTDYVSCLTIQ 849
gi 537145488  790 VENKDH-------------KVSLIFLGPSVRWFPFLYPNQVYRLVVPGPSMPMLFEAEGSSGTTQRPLELAGTQSCLTVQ 856
                         890       900       910       920       930       940       950       960
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 292495002  856 DNWTLELESSQDIQDVLDANKSLPES-------SLTDLLSDNFTDSLVSFSAEILSRTLCE-------PLVASLWMKL-- 919
gi 291405081  856 NEWTLELERSPDITDELSVNKALPES-------SLTNLLSSNSADSLVTFSAEILSRTLCE-------PLVGPVRKKP-- 919
gi 884896251  859 DEWTLEPESSQDVPEALSLQRALPES-------SLPSLLSGNFTDSLVSFSAEILSRTVCG-------PLLGRCWTKP-- 922
gi 297486784  858 DEWTVELASSQDIPEVLGIRPTLPES-------SLTDLLSGNFADSLVSFSAEIVSH----------------LWMKP-- 912
gi 281343206  842 DEWTLELESGPDFPAGPDTSKALPKT-------SLDDLLSGNSSDSLVSFSAEILSRTLCE-------PLPAPFWAKP-- 905
gi 731501747  878 DEWTLELERCQDIPDVLGIEKALPES-------SMTDFLSGNFTDSLVSFSAEILSRTLCE-------PLPAPLWTKP-- 941
gi 532094454  854 DEWTLELESS---PDVLGIPKALPES-------SLTNLLSANLTDSLVSFSAAILSRIMCE-------SLQPLCTQSLvm 916
gi 514725854  850 DTWHLQHETWLSSPAERQLAAKVMLTgmdqkiaSIPEILSTSFRSSLVSFSGEIVERILCAspknekpSVTLSLLKEKgs 929
gi 611994258  850 DDWILEPGNPQGIPGMLGISQGLSES-------SLTEILNGSSPGSFVSFSAEILSRTRCV-------SLSGT--TQQ-- 911
gi 157822211  850 EDWTLELGSSQDIPNVLEVPRTLSES-------SLAHLLSDNSPNFLVSFSAEVLSRILCE-------PPLALRRIKP-- 913
gi 537145488  857 KEWTLELGSSQDIPNVLDISKALPES-------SLTHLLSDNFSNSLVSFSAEILSRILCE-------PPLTLRRIRP-- 920
                         970       980       990      1000      1010      1020      1030      1040
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 292495002  920 --GNTGAMRRCVKLTVALETAECEFPPHLDVYIEDPHLPPSLGLLPGARVHFSQLEKRVSRSHNVYCCFRSSTYVQVLSF 997
gi 291405081  920 --ANTRAMRRCVKLAVALETADCEFPPHLDIYIEDPLWPSLQGLLPGARVHFSQLERRVSRSHNVYCCFRSSTYVRILSF 997
gi 884896251  923 --GSARAPRRCVKLTVALGTAHCEFPPHLDVYMEEPHLPVPLGLLPGARVHFSRLEKRVSRSHNVYCCFQSSTHVQVLSF 1000
gi 297486784  913 --GSSGAVRRCVKLTVALETADYKFPPHLDVYIEDPHLPPPLGLLPGARVYFHQLEKRVSRSHNVYCCFRSSTCVQVLHF 990
gi 281343206  906 --GGSRTSRASVKLTVAVEAADCQSRPHLDIYIKEPHLPPPLGLLPGARVHFSQLEKKISRCHNIYCCFRPSTYLQVLSF 983
gi 731501747  942 --GSPGAARKCVKLTVALETADCGSLPHLCVYIEDPHLPPPLGLLPGARVYFKQLEKRVSRSHNVYCCFRSSTYVQVLSF 1019
gi 532094454  917 -tGNTEDVRRCVKLTVSIETVDSEFPPRLDIYIEDPHLPPPLGLLPGARVYFYQLEKRVSRSHNVYCCFRSSTYVQVLSF 995
gi 514725854  930 llGS----DHSVKLSISVASGS---PAVLDVYIAATYTQHLWGLLPGAKILFQNLERKISRFHNVYCTYIASSCVTVLSL 1002
gi 611994258  912 --GNSQTSRYGVKLTVALDAADVASPIPIDVYIEAPHSPLPLGLLPGARVYFQHLEKKVSRFQNVYCRFLPSSYLRILSF 989
gi 157822211  914 --GNAGAIKAGVKLTVALEMEDCDYPPHLDIYIEDPHLPPPIGLLPGARVHFSQLEKKISRSNVVYCCFRSTTSVQVLSF 991
gi 537145488  921 --ENAGAVKTGVKLTVALEMDDCEYPPHLDIYIEDPHLPPQIGLLPGARVHFSQLEKKISRFNIVYCCFRPTTSVQVLSF 998
                        1050      1060      1070      1080      1090      1100      1110      1120
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 292495002  998 P---------PETTISIPLPHIYLAELLQGGQSPFQATASCHIVSVFSLQLFWVCAYCTSICRQGKCTRLGSTCPTQTAI 1068
gi 291405081  998 P---------PETTISVPLPTVHLAELLKGGQTPFQATASCHIVSVFSLQLRWVCAHCTSPCPQGRCILQSPACSTQTSV 1068
gi 884896251 1001 P---------PETTVSVPLPHIYLAEL-HGGRAPLRATASCHVVSVFSLELQWVCAHCSSVCLQGRCTRQDPSCPTQTSV 1070
gi 297486784  991 P---------PDTTVSAPLPHIYLAELLQGDKAPFRATASCHVVSVFSLHLLWVCAHCTSICPQGRCPRQSPACPTQTSV 1061
gi 281343206  984 P---------PETTISAPLPHIFLAELLQGGRAPFQASASCHIVSVFSLQLLWVCAHCTSLCPQGRCTRQGSTCPTQTSV 1054
gi 731501747 1020 P---------PETTTSPSLPHIYLAELLQGRQAPFQATASCHIVSVFSLQLLWVCAHCTSLCLQGRCTHQGPTCPTQTSV 1090
gi 532094454  996 P---------PETIVSAPLPHIYLAELQQSSCGPFQATASCHVVSVVSLQLRWVCAHCTSVCPQGKCLRQGPTCFTQTSI 1066
gi 514725854 1003 PashlvlpssPAGKASSP-SLVFLSNLQLHLQNLPQARILCHLSCVLTLSLQWVCSLCSSIFKEGKCTRHSPPCPSHTGV 1081
gi 611994258  990 P---------TEAPVSSSLPHIYLAELQGDSLGPSPASASCHVVSVLSVQLLWICAHCTSICVQGQCSRQGPPCPTQASV 1060
gi 157822211  992 P---------PETKASAPLPHICLAELLQGDRPPFQATTSCHIVYVLSLQILWVCAHCTSICPQGKCSRQDPSCPSQRAI 1062
gi 537145488  999 P---------LENKARVPLPHIYLAELLQGDRVPFQATTSCHIVLVLSLQILWVCAHCTSISPQGRCSRQDHNCPAQTAV 1069
                        1130      1140      1150      1160      1170      1180      1190      1200
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 292495002 1069 SQAIIRLLVEDGTAEAVVTCRNHHVAAALGLCPREWASLLDFVQVPGRVVLQFAGPGAQLESSARVDEPMTMFLWTLCTS 1148
gi 291405081 1069 SQASIRLLVEDGTATALVTCNHHHVAAALGLCPSEWTALLELVRGPGRVALQFTGPGAQLESSATDDEPLTLFLRTLCTS 1148
gi 884896251 1071 SQASIRLLVEDGTAEAMVTCKNHHVTEALGLCPSEWTSLLESARGPGRVALQFTRPGAHLESSAEKIGPLTLFLRALCTS 1150
gi 297486784 1062 SQASIRLLVEDGTAEAVVTCRNHQVAAVLGLCPSEWTSLLEFVRGPGKVALQFTGPGAQLESSAEVDEPLTLFLWTLCTS 1141
gi 281343206 1055 SQASIRLLVEDGTAEAVVTCRNHHVATALGLCPSEWTSLLESVRGPGKVALQFTGPGAQPESSAKVDEPLTLFLRTLCTS 1134
gi 731501747 1091 SQANIRLLVEDGTAEAVVTCRDHHVAAALGLCPTEWTSLLECVRVPGRVALHFTGPGAQLESSAKIDEPLTLFLWTLCTS 1170
gi 532094454 1067 SQASIRLLVEDGTAEAMVTCTDYHVAAALGLCANEWSSLLEFVRKPGRVVLQFMEPGAQLESSAKTEDPLTLYLHTLCTS 1146
gi 514725854 1082 RQASARVLVEDGTGEALVLCRNQHVAAMLGLSLPDWEAVQSCVQSRGRVSVQY-GEAPGMGCVEDPKDPVACYLRSLCRS 1160
gi 611994258 1061 SQANIRLLVEDGTAEAVVTCTNQQVAVALGLCPSEWDSLMELVRIPGKVALHTTRAGAQSEVTSKTDDPLMFFLQTLCSS 1140
gi 157822211 1063 SQASIRLLVEDGTAEATVTCRNHHVATTLGLSPSEWSNVLDRARGPGRVALQFKGPGAQTESASKTGEPLTLLLQTLCTS 1142
gi 537145488 1070 SQASVRLLVEDGTAEATVTCRNHHVAAALGLSPSQWTSVLECARGPGRVALQFKGFGAQTESPSKTHEPLALFLRKLCDS 1149
                        1210      1220      1230      1240      1250
                  ....*....|....*....|....*....|....*....|....*....|...
gi 292495002 1149 PSVLRPIVLSFELERKPSKIVPLEPPRLQRFQCGELPFLTHVNPRLRLSCLSI 1201
gi 291405081 1149 PCVLRPIVLAFELERKPSKITPLEPPRLQRFQCGEHPLLTRVNPRLRLSCLSI 1201
gi 884896251 1151 PAVLRPVELSFELERRPCNIGPLEPPRLQRFQCGELPVLTRLNPRLRLTCLSI 1203
gi 297486784 1142 FSVLRPMVLSFELERKPSKIIPLEAPRLQRFQCGESPFLTRVNPKIRLSCLSI 1194
gi 281343206 1135 FSVLRPVVLSFELERKPTMVTPLEPPRLQRFQCGELTLLTRVNPKIRLSCLSI 1187
gi 731501747 1171 LSVLRPILLSFELERKPSKILPLEPPRLQRFQCGDFPLLTRVNPRLQLSCLSI 1223
gi 532094454 1147 PSVLRPIVLSFELERKPSNITPLEPPRLQRFQCGE-PLLTRVNPRLRLACLSI 1198
gi 514725854 1161 PLICRPILLDFSLDRKPSKILQPAPLQLRNFRSGEVEFVSQTGPRQSLLCLNv 1213
gi 611994258 1141 PSVLRPVFFTFELKRKPTRVMPLEPPRLHRFQFGEIPVLTRVVPRLSLSCLSL 1193
gi 157822211 1143 PFVLRPIKLSFALERRPCDITPIEPPRLQQFQCGELPLLTRVNPRLRLVCLSL 1195
gi 537145488 1150 PAVLRPVKLSFALEKRPSDVTPLEPARLQHFQCGELPLLTKVNPRLRLVCLSL 1202
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap