Conserved Protein Domain Family
Dendrin

?
pfam15498: Dendrin 
Nephrin and CD2AP-binding protein, Dendrin
Dendrin is a family of eukaryotic proteins found in the podocytes of the kidneys. Dendrin, originally identified in telencephalic dendrites, is a constituent of the slit diaphragm, SD, complex of podocytes, where it directly binds to nephrin and CD2AP. Kidney podocytes and their slit diaphragms (SDs) form the final barrier to urinary protein loss. SD proteins also participate in intracellular signalling pathways. Dendrin appears to prevent programmed cell death (apoptosis) through its binding to nephrin. The SD protein nephrin serves as a component of a signalling complex that directly links podocyte junctional integrity to actin cytoskeletal dynamics. Thus, dendrin is identified as an SD family with proapoptotic signalling properties that accumulates in the podocyte nucleus in response to glomerular injury.
Statistics
?
PSSM-Id: 317849
View PSSM: pfam15498
Aligned: 6 rows
Threshold Bit Score: 799.532
Threshold Setting Gi: 1040220463
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 223590232   55 MDIQASYWARGPQSRTCRLRPGSPEPPPRRPWASRVLQEATNWRAGPPAEVRAREQEKRKAASQEREAKETERKRRKAGG 134
gi 928173472   62 MDFQASHWARGPQSRTCGPRPGSPEPPPRRPWASRVLQEATNWRAGPPAEARAREQEKRKAASQEREAKETERKRRKAGG 141
gi 1040220463  41 mdlQSSHWARGPRSRTCRPRPGSPEPSPRRPWASRVLQEATNWRAGPPAEVRAREQEKRKAASQEREAKETERKRRKAGG 120
gi 395540928   55 MDPTGGPWVQEPSSHRYGLDKKPPERLLRRAWVPRVLQEATNWGTGHPPEIRPREQEKRKAASQEREAKETERKRRKGGG 134
gi 884934010   55 MDFQASHWAPGSQSRTCRPRPGSPEPPPRRPWASRVLQEATNwragppaEVRAREQEKRKAASQEREAKETERKRRKAGG 134
gi 426372399   55 MDFQASHWARGFQNRTCGPRPGSPQPPPRRPWASRVLQEATNWRAGPLAEVRAREQEKRKAASQEREAKETERKRRKAGG 134
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 223590232  135 AR------------RSPLGQ------PRPEPRNALRAAQPTGFPVFSRPERFGQVGRAPRPSVLPQGDPG-VAWAGPWGG 195
gi 928173472  142 AR------------RSPPGR------PRPEPRSGPRVAQPVGPPAPSRPERLGPAGRPPRPSAQPQSDPG-AAWAGPWGG 202
gi 1040220463 121 AR------------RSPPGQ------PRPEPRNAPRAVQPAGLSGPSRRERLGPAGRAARPSAPPHSETG-AAWAGPWGG 181
gi 395540928  135 VRswsppglyrsepRSPLGRarggggSRQEPGNVPKTAQPKVRQFPWLPGHLGPAGRPPRPAAQSLRVPGtAARAGLRVG 214
gi 884934010  135 PR------------RSPLGQ------SRQEPRNALRAAHPAGLSAPPRPERFGQVGRAPRPPAQPQSDPG-AVWAGSWAG 195
gi 426372399  135 AR------------RSPPGR------PRPEPRNAPRAAQLAGIPAPLRPERLAPVGRAPRPSAQPQSDPG-SAWAGPWGG 195
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 223590232  196 RRPGPPSYEAHLLLRGSAGTAPRRRWDRPPPYVAPPSYEGPHRTLGTKRGPELSRAPTSSAPVPA---TTRTEGGRTKKR 272
gi 928173472  203 RRPGPPSYEAHLLLRGAAGTALRRRWDRPPPYVAPPSYEGPHRTLGSKRGPEPPQAPAPAASAPT---PARTEGGCAKKR 279
gi 1040220463 182 RRPGPPSYEAHLLLRGAAATAPRRRWDRPPPYVAPPSYEGPHRTLGTKRSPERSQASAASAPAPT---PARTEGGSARKR 258
gi 395540928  215 RPSGPPSYEAHLLLRGAAGPIPRKRWDRPPPYVAPPSYDGPHRTLGAKRPPQLPGLPAPLAPAPTlegKEREE--RPKKR 292
gi 884934010  196 RRPGPPSYEAHLLLRGAAGTAPRRRWDRPPPYVAPPSYEGPHRTLGTKRGPERSQGPTSSAPAPT---PARTEGGRAKKR 272
gi 426372399  196 RRPGPPSYEAHLLLRGSAGTAPRRRWDRPPPYVAPPSYEGPHRTLGTKRGPGNSQVPTSSAPAAT---PARTEGGRTKKR 272
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 223590232  273 LDPRIYRDVLGAWGLRQGRGLLGGAPGCTAARARPESCKGAIEKSSGLVAAGLNSAGDSHSQGKT-TGGPGTDAALSRSA 351
gi 928173472  280 LDPRIYRDVLGAWGLRQGRGLLGGSPGCGTAAPRPEAGKGAAERSLGPAAAGLSAGSDGRPQARA-AGSPSAQTAPAGSA 358
gi 1040220463 259 LDPRIYRDVLGAWGLRQGRGLLGGSPGCGAVRARPASGKGAAERGPVLPAAGLHGGSDRRFQATAvAGSPGSGTAPARPA 338
gi 395540928  293 LDPRIYRDVLGAWGIRQGRGALGGFPACGGLG----LGGKTSDKVSGVFLGGLNSNCSES------CSQPGAN-QIARAA 361
gi 884934010  273 LDPRIYRDVLGAWGLRQGRGLLGGSPGCAAAKPRLEFSKGGAEKSPGLATAALNSGSDSHFQADV-PSSPGTEIALAGPV 351
gi 426372399  273 LDPRIYRDVLGAWGLRQGQGLLGGSPGCGAARARPEPGKGVVEKSLGLAAADLNSGSDSHPQAKA-TGSAGTEIAPAGSA 351
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 223590232  352 --ISSPPRPVPRSRQHLRGSRKGKEG-SEQIWLPTCWLASPKKPPVRHSQTLPRPWAPGGTGWKESLGQREG--AEHEtl 426
gi 928173472  359 paARSPPRPAPRARPRLKGSEEGKEN-REQSWLPKCWVPSRKRQPPRQSQTLPRPWAPGGTGWSESPGLRAG--AGPS-- 433
gi 1040220463 339 aaPSSPPRPAPRSRHQLEGSREGKEGrREQVWLPRCWMLSPKKQPSRQSQTLPRPWAPGGTGWRESPGHGDG--PGPA-- 414
gi 395540928  362 tlTSGTSQTTARTQVPLRDVSEGERA-GEQSWSRETGGPSPGDQVAQHSQTLPRPWAPGSPREKESPGEGDGyqRSPKlp 440
gi 884934010  352 paTTSPPRTAPRFRHQLQGSREGKEG-RERIWLPKCWIPSPKKQPPRHSQTLPRPWAPGGTGWRESLGQREG--VGPEal 428
gi 426372399  352 taAPCAPRPAPRSRHHLKGSREGKEG-REQIWFPKCWIPSPKKQPPRHSQTLPRPWAPGGTGWRESLGLGEG--AGPEtl 428
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 223590232  427 EVWKVTRRAHTLPRISRGPAGREGIFVIDATCVVIKSQYVPTPRTQQGQLVPSGESCSVSDSLSQPKPcHEEEGEGAAAN 506
gi 928173472  434 EGGKGTRRAHTLPRSARGPARGEGVFVIDATCVVIRSQYVPTPRTQHVQLLPAGVPRAAGDAPSPPGP-SQEEGEGAAAL 512
gi 1040220463 415 -----ARRAHTLPRCSRRPAGGEGVFVIDATCVVIRSQYVPTPRAQQVQLLPSEMVRVVGDAPSPPKP-GPQQGEGASGS 488
gi 395540928  441 TDWKETHRAHTVPRSPHSSAGENGVFVIDATCVVIRAQFVPTPQIQHVQLLSSPGPRNGGNSLAFQKP-GKEEGEEEQAF 519
gi 884934010  429 EDWKETRRPHTLPRSSRGLARGEGVFVIDATCVVIRSQYVPTPRTQQVQLLPSGESRVVGDGPRQPNG-SKEEGERASVF 507
gi 426372399  429 EGWKGTRRAHTLPRSSQGLSRGEGVFVIDATCVVIRSQYVPTPRTQQVQLLPSGVTRVVGDSPSQSKP-GKEEGEGVTVF 507
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 223590232  507 PSVCQKRLLSSRVLNQPSEGR--ECEA-----EVGQQGDSSL-EERSSSGLGFPVGEVNPRDAP----TQPGSQEHPTLG 574
gi 928173472  513 PSPCQKLLPSSRPSHQLGGGR--GFEA-----EGGKPADSSL-EERASRILGLPVGEVNLRDAP----AQPGSPERSALG 580
gi 1040220463 489 PFRVPRPQLVS-LSHRPGEGSegEGEA-----EGGKPGDSSSlEERASRILGLPVGEVNLRGAP----AQSGRPEHPALG 558
gi 395540928  520 TSPCQKLLQNSRLFDQLSKGF---SDAwgegvEAGIPEDPSL-KERASRILGLPIRELDLGVSPnkcnSDPGGPNE---- 591
gi 884934010  508 SSACQKLLLSSRVLHQPSGEP--RCEA-----EGGKAEDSSHgGARGPHLWDSRAGEVHVPCAA----AQPASPEHAASG 576
gi 426372399  508 PSPCQKRLSSSRLLHQPGGGR--GGEA-----EGGRPGDSSL-EERTFRILGLPAPEVNLRDAP----TQPGSPEHQALG 575
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 223590232  575 PAAPVCAGSLKGSE-AAGVPRRAGGGWARTPGPYAGALREAVSRIRRHTAPDSDSDEA-EDLSVHSGSSDGSDTDAPGAS 652
gi 928173472  581 PAASGGAAPAEGPEgVAAAPRRAGRGWARTPGPYAGALREAVSRIRRHTAPDSDSDEA-AELSVQSGSSDGSDTEASGAS 659
gi 1040220463 559 PAAPAGAGCARGSG-GAAGPRRAGGGWARAPGPYAGALREAVSRIRRHTAPDSDSDEA-EELSAHSGSSDGSDTEAPRAS 636
gi 395540928  592 -TAARCADVARDSEpAPRVLRPAGPGRARDPGPYAGALREAVSRIRRHTAPDSDSDEA-PECGARSCSSEGSDTEASGTS 669
gi 884934010  577 AAAPADAGSVRGSK-VTAAPRRAGGGWARTPGPYAGALREAVSRIRRHTAPDSDSDEGeEELSVHSGSSDGSDTEAPGAS 655
gi 426372399  576 PAASGAQGRAEGSE-VAMVQRRAGRGWARTPGPYAGALREAVSRIRRHTAPDSDTDEA-EELSVHSGSSDGSDTEAPGAS 653
                         650       660       670       680       690
                  ....*....|....*....|....*....|....*....|....*....|....*..
gi 223590232  653 WRNERTLPAlgntrprEGGKTAGLSDSIREIVDVISQTEEG-FIREDTRKTPQGNRE 708
gi 928173472  660 WRKEPPRPG-------DGGKTAELSDSVRDILEVISRPEESlFGTRDSKGVPQGNRE 709
gi 1040220463 637 WRNEMTQPAagnpgpqEGGKRTEMSDSFRELLGAVSQTEEAlFGARDPAETPQADRE 693
gi 395540928  670 RQPEQSLPGtsgdqgeAGRRAGELRDCIREILDVICQTEEAlFRAEGSAQGKQGGGH 726
gi 884934010  656 WWSERTPPEtggtspgEGGKTAELK-AVsgrl------------------------- 686
gi 426372399  654 WRNERTLPGvgnsspeEDGKTAELSDSVGEILDVISQTEEVlFGVRDIRGTQQANRK 710
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap