Conserved Protein Domain Family
DUF4650

?
pfam15509: DUF4650 
Domain of unknown function (DUF4650)
This family of vertebrate proteins lies to the C-terminus of Ubiquitin-specific peptidase-like protein family peptidase_C98, pfam15499. It might be acting as the exosite for the peptidase.
Statistics
?
PSSM-Id: 317858
View PSSM: pfam15509
Aligned: 21 rows
Threshold Bit Score: 466.501
Threshold Setting Gi: 557019189
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1023003860  571 LLSGLEDLVDNDIITLTLTEI--------HVDSEGNPIENQPVIedqsviRD------KAVAEMDTLQKE---------- 626
gi 1023003856  577 LLSGLEDLVDNDIITLTLTEI--------HVDSEGNPIENQPVI------EDqsvirdKAVAEMDTLQKE---------- 632
gi 637285815   392 LLWGLENLADDDVITLTLVSV--------PLDSEGKPLEESHI-------EE------SLLANAGTPQLQdvgqvnmlpf 450
gi 326914266   564 AHCGSENLARDDLVSQILEET--------LLDSEGKSMLNRKMM------EN------N-LVEMSSWETQ---------- 612
gi 224043268   568 VHHGSENLADGDLVTLMLEEV--------PVDSEDKSVPNGRMV------GN------NFLDGWGTPEQE---------- 617
gi 514740316   563 THHGLENLAHNDLVTLMLEEL--------QVDSECKSLSNGQMV------GN------N-LVEMGTLQQQ---------- 611
gi 565309989   547 LLHGLDNLSDDDVVTLN-------------LDSGGQLLEDRLT-------EN------KQIIKTGPLQLQ---------- 590
gi 1032832325  152 VLSGTKGLVEAas--------------vfQVDFKDCLLEDKPVA------ES------AELVRALSLQPQ---------- 195
gi 148673914   552 VLSGAKGMVDS-ILPSALEETiqetasvsQVDSKDCLLEDKPVA------GS------AALVRVLAFQPQ---------- 608
gi 431920961   528 LLADPGGVIDSQILPLALEGI--------QVNSEDFLLENGPVA------GN------E-VARTDAAQSQ---------- 576
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1023003860  627 ---------E------------------LVLASSQTAPYRETPVQSQALPTSILNQNGSIDLKSDQLTPENTSDIISMNn 679
gi 1023003856  633 ---------E------------------LVLASSQTAPYRETPVQSQALPTSILNQNGSIDLKSDQLTPENTSDIISMN- 684
gi 637285815   451 tseenishnE------------------SILPEHRTVPLHQELPGNESNLFIMPTVLLSNS-----------------S- 494
gi 326914266   613 ---------K------------------SAFSPNASYTGELIGTDVPMNDKNTLSENSSICLSLQELNPACITPPVPKKh 665
gi 224043268   618 ---------E------------------PAFSLSTPYAGEFAGTSLAMNNKSMLYENSSICLPLEELNSVSITAPVPKKh 670
gi 514740316   612 ---------E------------------SALSPNT--PCEIAATDLAMNNTCTLPENSSICLPLQESNPANIIPPVPQNh 662
gi 565309989   591 ---------EldqkgvcplipegdiqkkSIVLGNTSAPMHEGQPSNASNLVTIPSVTLSNGK---------------INf 646
gi 1032832325  196 ---------D------------------SLMTSLLSNPYEGKLVTPP---------VVSTDPEAVPSQAGDTVIPNSVT- 238
gi 148673914   609 ---------Dsp---------------gSSGSSLVSSLCEGKLVAPC-VDSSFPSQAVSTDLQAVLSQAGDTVVPNPVT- 662
gi 431920961   577 ---------E------------------SLMASFVSAPRKEKLSQDQFADSSFPSRTVNADTQSAQRNTEGMVVATAVT- 628
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1023003860  680 PV-QVIALQQGEKP---LQI------------KerkvkfspitleKDAVSSPVLSTKVENFLSKS--N--VLSQES---- 735
gi 1023003856  685 NPvQVIALQQGEKP---LQIkerkvkfspitlE------------KDAVSSPVLSTKVENFLSKS--N--VLSQES---- 741
gi 637285815   495 NL-QTALPVQEAEPeanLVP------------V------------KDSGL---VNAKNEATKTKS--NntCQRAPN---- 540
gi 326914266   666 DP-NL----------------------------------------SDSLFAQSTDGKANLLNGERglS--SGQQINcklp 702
gi 224043268   671 DA-DS----------------------------------------SDSLPSQ-LNERTNLANRENglN--SELLLNklla 706
gi 514740316   663 NP-DP----------------------------------------PDSSLAQSTDDRANLLNRERglN--SELEINhkmp 699
gi 565309989   647 SS-EILLP-QGTKT------------------Avtl------vpvEENSNCHPKNAQKKTSKTKLgnT--VLGMAN---- 694
gi 1032832325  239 DA-PVPVPVQELKS---MVA------------E------------KDTQI-QLLPLSAERLKPAQ--P--AKSQAS---- 281
gi 148673914   663 DA-PVPVLVQELKS---LAT------------E------------KDSQT-QLLPLKTEKLDPEQ--P--GKSQAS---- 705
gi 431920961   629 DT-RAADPTQGVKS---AHV------------Egav------apeKSVPFKQLLSPETEKLKPEQ--C--VTLEIR---- 678
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1023003860  736 ----------NVKVANNAaG-DPQNIV----LGSTNNS-----SQSQKKKFVGSWVKGLLNKGVSFMPSCASANERKvh- 794
gi 1023003856  742 ----------NVKVANNA-AgDPQNIV----LGSTNNSs-----QSQKKKFVGSWVKGLLNKGVSFMPSCASANERKvh- 800
gi 637285815   541 ----------TLEKKRKI-T-GHCHVP----ASSNSSQs---pPKNGMKS--ANWVKTLLGRCPS-VPKSASVFIKE--- 595
gi 326914266   703 pvenivekspDLKGASKI-A-VHSQVT----TSSADNNsfqssDKDQKRGFVGSWVKKLLSKNTSFLPSSALMPKNErsc 776
gi 224043268   707 ven-tiqnppDLKDASKT-V-VNSQVG----SSSGVSNsvqssYKDRKGGFVGSWVKK-LSKSTSFMPSSSSALKNErnc 778
gi 514740316   700 pvgnigqkspDLKDAGKT-V-VHSKVA----NSSADNNsfqpsHKDQKRGFVGSWVKKMLSKNTSFMPSSASAPKTErsc 773
gi 565309989   695 ----------VVEFGQEI-K-INSHIS----APSPQSPtfhssSTNGIKPSVASWVNGLLGKYSSFMPKSVVIPNKSkkc 758
gi 1032832325  282 ----------NVRKRETA-A-SSKTVM----ASSLQTQp---qKDDQKKAFVGSWVKGLLSRGGSFMPPCVLAQNR---- 338
gi 148673914   706 ----------NLRKRETT-A-SSKTVA----ARSAQNQp---rKEDQKRAFVGSWVKGLLSRGGAFMPTCVLSQSR---- 762
gi 431920961   679 ----------NLKKKETSlK-KKKTLTfsqmAKPVPDPp---lEAARKKPFVGSWVQGLLSKGASFMPPCVSAHSRS--- 741
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1023003860  795 ----lqKTtdLNSLVKR--ANNFRGFKPKGItNQTSPQTPKKTSRSAcN------SLPVPNS----SPSNISTPLmsgKV 858
gi 1023003856  801 ----lqKTtdLNSLVKR--ANNFRGFKPKGItNQTSPQTPKKTSRSAcN------SLPVPNS----SPSNISTPLmsgKV 864
gi 637285815   596 ------ETssKKPTLSGrhALHFRGFETKFS-RKLAKQ-----------------DSPPTNL----LPPSATSLShptIK 647
gi 326914266   777 ktpsvqKLsdTWLPVKG--ASNFGGFQGRGE--RKTSQPLTSVLPRS-N------NAHYLSKfkgfSQGTCLP-QnhsAM 844
gi 224043268   779 ktpsvqRIseVWLPMKG--ASNFGGFQSRGT--KKTTETPKLLAPQS-N------NAHPLSNfkgfSQSTYLPTAnhtTI 847
gi 514740316   774 ktpsvqKLneMPLPVKR--ASNFGGFQGRGV--NKATEAPKSSLPRS-NgtnflsNfr------gfSQGTCLPAKnraAL 842
gi 565309989   759 k-ksmqKEttSSSLVRQ--AVHFCGFQTKSS--QKSKVATLHSS----G------RTLPTS------PLTAFSLAsipVK 817
gi 1032832325  339 ------AVtdLQPSVKG--ANNFDGFKTKNV-NRKAKRMSRKASKHV-D------EPTAGSC----SPPS----GstaTL 394
gi 148673914   763 ------AVsdLQPSVKG--ASNFDGFKTKSI-SRRSKRMSRKAKHME-E------LSPRNSS----PPLSwt-----aAL 817
gi 431920961   742 ------AVadLQPSVKG--ASNFGGFKTTGK-RQKANQASRRARGCA-S------KPPPASG----PPASPPWPgg-aAL 800
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1023003860  859 LEDTKTLTKSLHKNF---QP---LSSEISPKHNfngnenHISSGTY----ESQTHKLRLKLLKKLKAKKQKLASL----Q 924
gi 1023003856  865 LEDTKTLTKSLHKNF---QP---LSSEISPKHNfngnenHISSGTY----ESQTHKLRLKLLKKLKAKKQKLASL----Q 930
gi 637285815   648 KHAAVGSDGTVTNKS---GSwvtLNKQIQPNQNcnenkkTISLKNgk-lvVDQTQQLRFELLQQLKAKKEKLASLdk-lA 722
gi 326914266   845 EDPTWNKSGNTLGSS---GK---TTQVHPPSYNsvkaeeSNS---------DKTRKLRLKLLKKLNAKKKKLASLdrlaV 909
gi 224043268   848 AGPTWTKSERTLGTP---GK---VTQFPSPGYNsgkaeeSDS---------DKTKKLRLKLLKKLNAKKKRLASLdrlaV 912
gi 514740316   843 EGPAWNKSGNMMSTS---GK---TTQFQSPSHNagkveeSDS---------DKTRKLRLKLLKKLNAKKKKLASLdrlaV 907
gi 565309989   818 NLAPDRKGEAVTKRSgslDA---FTKQDLLKNThhenlnFLSVENTgs-fiDKTHQLRLTLLQQLKAKKEKLASLdklvK 893
gi 1032832325  395 PHAGGNATSILLKG----QE---SSRATPLSNNlhssesVISPASCgdaaEDQVHKLRLKLLKKLKAKKKKLAAL----M 463
gi 148673914   818 TQAAENATSALLRE----QE---GSRPAPLRHRspgnesAISPASRgdaaEDQVHKLRLKLLKKLKAKKKKLAAL----I 886
gi 431920961   801 PHAVVSASPRVVARC---DS---ASLGAPLGHGshrddiDVSSTNPgnsvEGQIHKLRLKLLKKLKAKKKKLAAL----M 870
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1023003860  925 ALQIN--------------GKPPKKSKKHLAPAGSQNECESLQ-GLLRELQDHIDATDNTPNGTTHSGISLNSSPTHEEF 989
gi 1023003856  931 ALQIN--------------GKPPKKSKKHLAPAGSQNECESLQ-GLLRELQDHIDATDNTPNGTTHSGISLNSSPTHEEF 995
gi 637285815   723 KSQVR--------------KKRSKKTEKNQSQPGSQKEGDSLQ-RLLNDLQRQIDVEDSKSVNSPATTVSQCSSSSYDDI 787
gi 326914266   910 EQAKR--------------GKPVARDVSAPSQTESHNDSELLQ-NFLRELQYHIDAADNSSEFSVNS--GCSSHNSNDEI 972
gi 224043268   913 EQRKR--------------EKHVSGDISTPSQTESQNDSELLQ-SFLRELQYQIDVTGHQSDLNANTVPGCTGHDNTDEI 977
gi 514740316   908 EQMKR--------------GKPISGDVSTPSQAEPHSDSELLQ-SFLRELQDQIDAADNPSEFSVTS--GCSSHNN-DEI 969
gi 565309989   894 AKTRH--------------KNSCKKTIKN----QTQKQMEPLQtSMLDTQEMQTDVWDSKSVNSQSTDISQCSSSNYDDI 955
gi 1032832325  464 SSPNR--------------GTSVSDHSEPVSHCGSPNDCESIE-DLLNELQYQIDLADNKSGCTTAPDGTSCNSQSHEEI 528
gi 148673914   887 SSPHRepslsdhsepashcGTPASDQSEPVSHCGSPNDCESIE-DLLKELQHQIDLADSKSGCTSAPDATSNNSQSHEEI 965
gi 431920961   871 SSPQN--------------GKLPGENVEHVSHCGSPNDGESIE-DLLKELQYQIDLADNKCGGATVPGVAPYGTQAHEDI 935
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1023003860  990 LAE-LLSS-STVVSSEPPRDREDDYEYLEMVDNHNTIPT-PSDFVCDLSSANPSKDHNY-SPAKQSQYEVEVDSLMNNSC 1065
gi 1023003856  996 LAE-LLSS-STVVSSEPPRDREDDYEYLEMVDNHNTIPT-PSDFVCDLSSANPSKDHNY-SPAKQSQYEVEVDSLMNNSC 1071
gi 637285815   788 LSE-LLSPaTTVASLELPH--EEECRYLEMGGGS---PI-SSISNENPDEI-IGHDHNYhTPEKQNGVEDQTDLLAVRSP 859
gi 326914266   973 LAE-LLSPtSTVASSEVPK-SEDECMYMEMVNSSSAAPAePAEKTSVSHAAMTSEDHSYySPEKGSNYEH----TMSKSS 1046
gi 224043268   978 LAE-LLSPtSTVTSLEAPK-SEDECMYMEMVHSSVATTV-PYESTSVPQAAVTSEDHNYySPVKDTNLELD---AINKHS 1051
gi 514740316   970 LAE-LLSPtSTVASSEVSR-GEDECMYMEMVDSSGPAAL-PEEETAGSQAAVTSEDHNYySPVKDSNYELH---AVSKPG 1043
gi 565309989   956 LSElLLSPtTTVGSLEFPQ--EEECRYLEMGDSNSDMPI-STDHNTSLQT--IDNDLNYfSPLKENGLEDHRNPSVK--P 1028
gi 1032832325  529 LAE-LLSP-PA--LSEPSASVESELRYLEVGDS-TP--A-PTEFNAVSQSICLGQDHNYcSP-KKNQCEAEVQSLTDSAC 599
gi 148673914   966 LAE-LLSP-TA--MSEPSESGELELRYLEMGDS-TPAQA-PSEFSVVSQNTCLKQDHDYcSP-EKGQREVDLHSVMDSAC 1038
gi 431920961   936 LAE-LLSP-AA-VSAVLSEPGEADLRYLEVGENRVPAPV-PSELSSVPRHARLGQDHDSrSPAKDNQCGVQPAPLTGHAC 1011
                          650       660       670       680
                   ....*....|....*....|....*....|....*....|....
gi 1023003860 1066 DKTLSLENPLK-TDIFDEFFSTSVLNSSANDIEYLPHFDDYMFD 1108
gi 1023003856 1072 DKTLSLENPLK-TDIFDEFFSTSVLNSSANDIEYLPHFDDYMFD 1114
gi 637285815   860 LKKLEFGNPEK-QDFLDDLFPSSMLNSIMADVEDLHNFDETLLt 902
gi 326914266  1047 VKKIGFESPTR-DDILEDLFSISAPTTMAGDI-DVPHFDETLFE 1088
gi 224043268  1052 VKKLSFESPTR-DDILEDLFSISAPSSMSGDM-DLPHFDETLFE 1093
gi 514740316  1044 VKKLAFESPPReEDILEDLFSISAPSSTAGDI-DLPHFDETLFE 1086
gi 565309989  1029 LKKFDFESSAK-QDFLDDLFSCS-LNSVITNTEDLHHFDESLLa 1070
gi 1032832325  600 IRALNLGSPMK-TDIFDDFFPTSALNSLANDTLDIPHFDEYLFE 642
gi 148673914  1039 IRTLNLGSPMK-TDIFDDFFSTSALNSLTNDTLDIPHFDDSLFE 1081
gi 431920961  1012 SRTPSWESPVK-PDVFDDLFSTSALNSLAHDTLDLPYFDEYLxx 1054
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap