Conserved Protein Domain Family
MvaI_BcnI

?
pfam15515: MvaI_BcnI 
MvaI/BcnI restriction endonuclease family
This family of proteins includes the restriction endonucleases MvaI and BcnI. These enzymes both function as monomers. MvaI cleaves the sequence CC/WGG, where W is an A or a T nucleotide, leaving sticky ends. BcnI cleaves the sequence CC/SGG, where S is G or C, leaving sticky ends.
Statistics
?
PSSM-Id: 317863
View PSSM: pfam15515
Aligned: 30 rows
Threshold Bit Score: 179.383
Threshold Setting Gi: 81420474
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123649567  212 DKLIEIAKQPL-KSI--MKGd-TAI---------GMTIEHALGLTANSSKKPDYKGIELKSG--RITKsktRSN-----L 271
13_pfamImport   2 QKIQAIHNQGFlPSI--TPGd-PGV---------GDTLEHALGIERNNSRAPDYKGIELKTT--RLTRngsSRQitrstL 67
6_pfamImport    2 GMIKDISGQWH-QGLpgLRRd-LEV---------GRLLEELLGLPANSSKSPDYKGIEIKAG--RIRStnr------qtL 62
1_pfamImport    2 EKLRVIHQKGWiRSRklGSN--GVIlpceapncgGMTLEAELDIIPNSRSEPDWLGYEVKQYnvTNFQrinSGVl---tL 76
gi 81420474   190 TRLKEIYSYGFiKSQrlDKN--GNVieyrarngaGFTLESLFGIIPNGRSGPDFSGWELKAHs--------GSVv---tL 256
10_pfamImport   2 KELSRIYQLGWiPSKrlDKY--GAVldcnapncgGYTLEAELGITPNGYSEPDFLGWEVKQFgvTNLKkpgNAVi---tL 76
27_pfamImport   2 AKFIELSEKGWvKNR--RMGnsGGV---------GNTLEDYLGIEENNLPIPNAAEWELKAQ--RKNT---TSLv---tL 62
4_pfamImport    2 KKLRDIRNLGWiENL--RVGnaGSI---------GNMLEDLLGIKENNLAIANAGEWELKTK--RKNS---SSLt---tL 62
5_pfamImport    2 QALREICNRGWlASG--RQGnaGGV---------GNTLEDLLGIEENNLPIPNAAEWELKCQ--RAST---SSLt---tL 62
gi 123579577   11 QSLKIIAAQGWiENA--RHGnhGGI---------GNTLEDLLGIAENNLPIPNAAEWELKAQ--RLNT---SSLi---tL 71
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123649567  272 FAQVPawd-----ksVLKSSREIVDSYGYPD----KDNGd-----QRLYctvnv-snfnNQGLRLVVDLENDKVY----- 331
13_pfamImport  68 FTKVPd---------VGMTYREIVDHYGKIQiprgDTLPr-----LQLYetfrv-srpnAYDLVLEVDQNNDQLRml--- 129
6_pfamImport   63 FAKVPdws-----isPVKSSAELVDIFGYSR----GEKYr-----RRLCcsvsg-akpnSQGLYLEVVETPHRLAer--- 124
1_pfamImport   77 MTPEPtgg-----yyRSAGIEAFIRKFGYPDmtgaADRGd-----RLNF----------GGIHKVGEYHRLTSLQivlkg 136
gi 81420474   257 MTPEPnk------geYIENLHKFMSDYASSK----KEd-------RVDF----------ASIHKIGLLNEKTKLTlyleg 309
10_pfamImport  77 MTPEPteg-----lyVSEGVEYFIRNYGYPDqngrEd--------RLNF----------GGVHKASIKHPRTSLTlelig 133
27_pfamImport  63 FHSEPspralkfvpcVLLP------HYGWQH----KEAGrkypetEMSFrqtit-ckysDRGFCVKVDRDAEKILiv--- 128
4_pfamImport   63 LHNEPsprkagivanLLLP------FYGWQH----QEAGhkypnsELSFrqticckrfsDRGFTVELDRENEKIIir--- 129
5_pfamImport   63 FHMEPspralrfvpnVFLP------KYGWPH----DLAGieypssEMSFrqtihglsrsDRGFMVVIDRNNRKVTis--- 129
gi 123579577   72 FHIEPspraikfvsqVLLP------NYGWKH----QQAGkkypenEMSFrqtihglstsDRGFQVNIDRKNQKVVis--- 138
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123649567  332 ---EEHEID-----------------------GLIvVWEGQKLRERLLEKHHETFWISANVNIINGLEFYSLNGFTHTKN 385
13_pfamImport 130 --hQEEKLR-----------------------KYVsAWYLNTLKQTLLLKHHETFWVKAVSENREGREWFRYDRILHTKN 184
6_pfamImport  125 --sNKLDYP-----------------------DVA-YWPMDALKETLLAKHPETFWVRANCIKNGASELFRYEKVLHTKR 178
1_pfamImport  137 fdaIKGKITdatggis----------lmniegEEAaVWGYAEVMAKWNRKHNKAVYIPSRCVQSPERRYWYGNLIRIGTG 206
gi 81420474   310 ydfDKKKIIdpdgglv----------lrsingNIAaGWNFGKLLDHWKRKHSKTCFVSYDVKNGDFPYYKFGPQIVLATG 379
10_pfamImport 134 fdaDAGKIKsaggkia----------lvdeqgNEAaAWSFAALLQHWNRKHNQACYVPSKSETDPLRRYCYGNLVTLGVE 203
27_pfamImport 129 --fNPLEVDpkhsdwlnqvyqnidsgctnictMQP-YWGFRDLSCKAGGKLLNCFYVQADVKREEGEEYYWYNSVKILQN 205
4_pfamImport  130 --fDASKIDpkhndwlkkv---dqriglgnlnPEP-YWGFRDLSAHIGSKLTNCFFILVDVKKENGKEYLQYNDIKMLSN 203
5_pfamImport  130 --fDANAVDirhsewkevv---kekiglgelnPQP-YWGFDDLFHKAGTKLLNCFYVVADSKREAGVEYFRYSRILQLEG 203
gi 123579577  139 --fDWNCVAekhhkwlqsv---knrigleqlnPQP-YWGFDDLSNKAGTKLLNCFYVQAEVKKEAGKEFYKFSKVMMLQK 212
                         250       260       270       280
                  ....*....|....*....|....*....|....*....|....*....
gi 123649567  386 PMEHQLLPLIKQGVITLDH-LIKRKNETGRTSEKGPFFKIKPQDLEMLF 433
13_pfamImport 185 PNTSLLAPLLEADKITVDL--AAHYKPDGKWRDHGMLFKMMPDDLPLL- 230
6_pfamImport  179 PIASALPTLLETGAVTVDH-LITRDH-AGRVRERGPLFRIDKRNFDLLF 225
1_pfamImport  207 TDFLKYLQAMAEGKVYYDPgIKLENASTTPRTKQRSQFRIKSSNLPALY 255
gi 81420474   380 ANLNKFINALESSKIYYDPgVNIKYQEGLSKVKKRNQFRIKWKDVLSIY 428
10_pfamImport 204 TDFQLFLAQMHLGNIYYDPgIKMENISVKPVVKRRSQFRMSSQYLGSLY 252
27_pfamImport 206 FSFKGFLDALESNNIYIDFdar-------sgHNHGTKFRMSESAWPLVY 247
4_pfamImport  204 FSMNKFIDTFEDNLIYIDFdar-------tgHNHGTKFRIRETNLPLLY 245
5_pfamImport  204 FSLDKFLRALELGDVLVDFdar-------tgHNHGTKFRLRQDKLPSLY 245
gi 123579577  213 FNFDGFLSQIEQGNILVDFdar-------tgHNHGTKFRMRQNCLPTLY 254
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap