Conserved Protein Domain Family
Ntox25

?
pfam15530: Ntox25 
Bacterial toxin 25
A predicted RNase toxin found in bacterial polymorphic toxin systems. The toxin possesses a mostly all-beta fold and conserved FGPY motif and a histidine residue. In bacterial polymorphic toxin systems, the toxin is exported by the type 2 or type 5 secretion system.
Statistics
?
PSSM-Id: 317873
View PSSM: pfam15530
Aligned: 3 rows
Threshold Bit Score: 259.044
Threshold Setting Gi: 553955172
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 502673028 2775 VPPRVQQDTSLAIDLGQKGQGYGEINNAIDASHLGPSWGTEYKVKTNGKIEVSGGIGPALKGEMKVNNDYFSVSTGYTKE 2854
gi 500264437 3796 VPPRVQQDASLAFDPSQQGKSAEEINAAIDASHLGPSWGTEYKVKPYVKGEVAAGTGPGYYYDTSIDPYQISANRGETLA 3875
gi 553955172  198 VPPRVQQDASLAFDLSGKGVTNDEIIKAVDKSHIGPSVGDTAKIHGDVKGQVAGGYVAGGYLEGVLSEDKFSINGGVTKV 277
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 502673028 2855 FGAKAGASIGIDFGPYDFGVFgDLHRDYSTSIGYGPGSVGLSVGQDGLGFSFSVGPSIGFTGSSTVPHSEKIEMNGDTTK 2934
gi 500264437 3876 VGGRVSGQIGIQFGPYFPGAI-DSERNSSIGLGLGVISSEISYGKDGFSFSFGVGPAWGWSGVSTNAAGEKVDINGSSGT 3954
gi 553955172  278 LGWRADVSAGLTFGPYPIKDF-NPAYDYSGAISTGIFSVEGSIGKDGFGGSFRVGGGIGASIRQSENSNNQPEINGSGST 356

                  ....*...
gi 502673028 2935 EIYHYDFK 2942
gi 500264437 3955 EFYHHDFG 3962
gi 553955172  357 ELISWPIK 364
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap