Conserved Protein Domain Family
DUF4655

?
pfam15548: DUF4655 
Domain of unknown function (DUF4655)
This family of proteins is found in eukaryotes. Proteins in this family are typically between 533 and 570 amino acids in length.
Statistics
?
PSSM-Id: 317882
View PSSM: pfam15548
Aligned: 11 rows
Threshold Bit Score: 409.636
Threshold Setting Gi: 620964848
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 928144893   13 VRTNKTGSNIAVSAPKGSEDT-N-TTHQQGQEYFLASSSRSAAAPVSPPPHR--RSEAGHLTTFYPTSDYPRSVSPQSGP 88
gi 982955990   13 VKTNKTGSRVAVSTQKGAEVT-S-MTPQRGQGYLISSSQRSGPASTIPIGHR--RSEAGHATALHLSSDYLRSSSPQSGP 88
gi 620964848   13 gTVNQAGSKMAVSAQRAAQVSlS-PSPQRGPTF-----SLSASSQQSAEIYL--RGPDASPPSPPRGPDTSRTSSPQRGS 84
gi 967048856   13 VKTNKPGAKVAVSAQRGSEVT-TnTSPQRGHGYILASSHRSAAVSLNPS-HR--RSEAAHPTTPHSASDYPQSVSLQSGP 88
gi 831235493   13 LKTSKTGSKI--SAQRGSEVR-D-ASPHQGQGYIFGSSQQNGSVSPIPSAQRrsRSEAAHQSMSRSPSDFPRSLSPKPGP 88
gi 545858915   13 VKTNKVGSKVAVSAQKGAETM-N-TSPHRGQGYVPASSPRSGAASINTSPPR--RSEAGHPTIFYSTPDHPRSSSTQTGP 88
gi 511845873   13 VKTNKAGSKVAVSAPKGSEDT-N-TTSQREQGYILASSSRHASVQMSPSLLR--RSEAGHLTTLHSTSDYPQSSSPQSGP 88
gi 655870398   13 VKTNKIGSKVAVSTHKRSEVH-S-SNPQQGQGYFLASSQRSAAVSLSPPPQR--RSEAAHPTTPHSASDYPRSSSPEPGP 88
gi 351706635   13 lRTNKSGSKV---AHRGPEFT-S-PTSQRGHEYIFATSQQSAAVSGSPPP-Q--RAEAAPPTTSHSASYSPHTVSPQSGP 84
gi 348562518   13 LKTNKSGSKV---AHREPEFA-S-PTSQRGHRYVFTTSQRNAARSQSPSSLQ--RVEAALPTAPHSASYSLHTLSPPSGT 85
gi 532072335   13 VKTNKTGSKVAVSAHKGAEVT-T-STPHRGHGYLLSSSHRSAAVSLNPSPQQ--KLEAALPTTPHSASDYSRFVSPHSGH 88
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 928144893   89 GLAGTSIP-RgSET----------------------------------------------RSKLETYRHPSPHRKTQQTQ 121
gi 982955990   89 GPSGAPNP-R-TET----------------------------------------------RSRTDTSRQASPSRKLTQGE 120
gi 620964848   85 VASRTSSPqRgLDAsratspqrgpdpapatcpprgpscthatspprdpessarrgtdgppRQRAELAGGPSPQRRAEFTQ 164
gi 967048856   89 GHYAVPTP-RvTET----------------------------------------------GPRTESSRHSSPPRKNQQTQ 121
gi 831235493   89 SVSPASTP-RgTES----------------------------------------------RSRTEGSRHSSPHRKVQQTQ 121
gi 545858915   89 GLSGAPSS-R-MET----------------------------------------------RSKSEAYRHISLPQKMQQAQ 120
gi 511845873   89 GLAGTPIP-RgSEI----------------------------------------------RSKSETSRHPSPHRKSHQNQ 121
gi 655870398   89 GFSAAQFS-RgTES----------------------------------------------RPRTEAFHHSSPHRKTQQVQ 121
gi 351706635   85 SLYTASTP-RgTET----------------------------------------------RPRV-----SNPQQKSQQVH 112
gi 348562518   86 SLYAPSTP-RgTET----------------------------------------------RS------HGPSQQKSQQSQ 112
gi 532072335   89 VHSTAQFH-RgTET----------------------------------------------RTKTEAHRHHSPHRKNQQVQ 121
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 928144893  122 TSAyHTVQ-----------------MQRNISPCREESTRKGGESKPGR-DISNRYSLTPDAKSS--RRLSFV--DQK--D 177
gi 982955990  121 SML-YTGQ-----------------VQQNVSPSREEATRRGVEIRPGR-DISNRFSLIPEAKSS--RRLSFV--DQK--D 175
gi 620964848  165 NVSsHVSGssrpgkvtvaadtlliaMQRSINPQREEAPRRGSLFS-GS-ETTCRTSFSPDTKGSppRSTSVVktDVKpaE 242
gi 967048856  122 TLAsHASS-----------------RLRNVSPPGEEAARRGGESKSGR-EVGHHASSIPDAKST--RRLSFQ--DQK--D 177
gi 831235493  122 TTPsFSIS-----------------MHRNVSPVREEATRKSSEAKQMRnEVSHRASSALDAKYF--RQLSFL--DQK--D 178
gi 545858915  121 GSApFDVQ-----------------VPRNVSPSREESTRRGGESKPGR-DASNRYSVLSDAKSS--RRLSFV--DQK--D 176
gi 511845873  122 -IAsHAVQ-----------------MQRNVSLSREESTRRGVESKPGR-DMSNRNSI-PDAKSS--RRLSFV--DQK--D 175
gi 655870398  122 TVPsHAVS-----------------SHRNASPLREESARRSGENKPVR-EVSYRGSLTPDAKSS--RRLSFL--DQK--D 177
gi 351706635  113 TAPpHPVS-----------------IHRNV---KEEATRRGGEIKPGC-EVGCRTSLTPNAKSS--CLLSFI--DEK--D 165
gi 348562518  113 TTPaHPVS-----------------ICRNV---KEGATRRGGKIKSGC-EVGCCTSLTSDARSS--RRLSFI--DEK--D 165
gi 532072335  122 TPAsHSTS-----------------VHRHLSPVREEAMRRSGESKPGR-EVGHRISP-PDAKST--RRLSFM--DQK--D 176
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 928144893  178 NLQi--LQEE-DPPSKVQYPQGVRVPRRTLACPKDQAVQTEPIRKILTATEIRSPKRPSSPEHSSGRVRADSRTAQRRIP 254
gi 982955990  176 DFT---LLED-EPPSKVQYPQGVRVPRRPLICPKDEAVQTEPIRKNMTAGDIRLPRRPPSPERGGNRIYPDSRSTQRRIP 251
gi 620964848  243 PIRrtpLQPEpDSPSGTSAPQGTKCPRRHLIHPKDEATQTDPPRRGPVPPGTR--------PSQKVAAAPDPESAGRDSG 314
gi 967048856  178 NLQsqiLQ-D-DPPSKVQNPQGVRVPRRILTYPKDEAVQTEPIQRITTASEIRSPRSPSRPEHRSSCVSADYQTAQRKVP 255
gi 831235493  179 NSQsqiLQ-E-DPPSKVQKPQGVRVPRRISVYPKDEAVQTEPIRRIT--AEVRSSRSPPAPEHGSSRVSAEPRGLQKKIA 254
gi 545858915  177 NLT---ILED-DPPSKVQCPQGVRGRRRSLVYPKDAAVQTEPIQKSSTAAGTRSPKRPPSPEYSSSRSHTDYRTTQRRVP 252
gi 511845873  176 NLQi--LQED-DPPSKVQYPQGVKIRRRTLVCPKDEAVQTEPIRKGLTATEIRSPRRPSSPEHSSARVSADSRTALRRIL 252
gi 655870398  178 NYQsqiFQEE-DPPSKVQNPQGVRVPLRISIHPKDEAVQTDPIRRTLTTSEVRSPKNPYYLEQGSSRLTTDHRAVLRKIP 256
gi 351706635  166 TLEsqnLQ-E-DPPSKVQNPQGVRVPRRISSYPKDEAVQTEPTGKILT-GEVRSPRSPTSPEHGSSRVATDHRAAHKRSH 242
gi 348562518  166 NVKsqnYQEE-DPPSKVQNPQGVRVPRRISANPKDEAVQTEPIGKILT-GEARSPRSPTSPEYGSSPLPTAYQAVYRRSP 243
gi 532072335  177 NLQlhnLQ-E-DPPSKVQNPQGVRVPRRISAYPKDEAIQTETTRKILSVGEVRPPKRPSSPEHGHSRM-VDHRTVHRRLT 253
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 928144893  255 GQEYEMNRLSSIYTEPKALHRNMNLESSLRLSVLKDLDGGHRV-SLHPDPESIHKHSVYTDTKPSPKILISSEVESNMKS 333
gi 982955990  252 GPESDTGRQNSIYAEPKALRRSVNLESSLTLSVLKDLNSGHKA-SMRPEPEPGHRPSVYNEIKFSPKVLIPSEVEPSTKP 330
gi 620964848  315 SPEAKPPPRGSACLEA---------ESAFRISLRTEAELAQRT-LGRPDPEAGHRGYASPEVRSPSRVVAGSEVESARRV 384
gi 967048856  256 VEESETGPYSSIPSKPKALYRNMNLDSSLKLSVLKDSDGVHRV-STRVDPESLHKYSVYPETKPSAKVLISSQVESNVRA 334
gi 831235493  255 REEPEMGPRSSVLPDSRAVQKNMHLELPHKFSTIRELDSGHRV-SVRPDPESSRKHSAYPETKYSPKFLI-SEVESNMKS 332
gi 545858915  253 CQESEMSRQNSIYTEPKALHRNRNLESSLTLSVLKDFDGGFRV-STRPEPESIHRHSAYPKTKPSPKVLMSSKLEANVKS 331
gi 511845873  253 GQESEMNRPSSICTEPKALHKNMHVESSLRLSVLKDLDGGRRV-SARPDPESVPKHSVFADIKSSPKISIPTEVESNLRP 331
gi 655870398  257 AQEPEMGPYSSIPSEPKASHRNINLESSLKLSVLRDLDDRHRV-PSRSEPESLCKHSVYAETKPSSKVLMVSQVESNMRS 335
gi 351706635  243 GQESQMDPYTSVLLEPKALHRNMKLTSSLKLSVLKDLDGGHRVpPRHSEHESLYKRSVSTETRPS-KVLISPDVEPSVRS 321
gi 348562518  244 AQESQMDPHSSVLSEPKALHRNMKLSSSLKLSVLKDLDGGHQVpPAHSEPEYLYKNSVYTETRPS-KVLISPDVETCVKS 322
gi 532072335  254 SPEPEVDHHSSTPSEPKAFQRNMKMASSLKLSVLKDLDGGHR--AAHSAPETLYKHPAYTETKHSPKVIMSSEVESNMRS 331
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 928144893  334 STRGDS---EVGRRVTISPEGQLihsASHVTSRTASESPQKS-IFVTPEHSYKQ----HPQKPSECVSMSPGPALRYP-- 403
gi 982955990  331 SARGES---EGGRRVTISPGAQS---ASRRTSRAASESPRKSsVLATPEPEYKQ----YIAKPSDSIYEFPRPTLRPP-- 398
gi 620964848  385 HICPDP---EPPRKVSLHPETES---PRRVSGRLAPDTSRKAaVQLEADAFRRAavqlETESPRRVSIRSAPDAPRRAav 458
gi 967048856  335 PIRGNN---EVGRRVTISPGVQSvepTHRVTAQSVSEGSHKSsMFVTPEPIYKQ----QTPKPPETTYMSQGPTPRYP-- 405
gi 831235493  333 PTRGDS---DIGRRVTIS----ElqpTQRGTAPSMSQSSRKSsAFVSSEPTYKQ----QTPKPTETTYMSSGPALRYP-- 399
gi 545858915  332 SIRGDT---EAGRKVTISSGRQTvqlPSHVTSRAVSESPHRSsVSATPEPTYKL----HTKKPSGNVFRSPRSASTYS-- 402
gi 511845873  332 STRGDN---EVGRRVTISPGGQLlhpAPRVTSRAMSESPPKP-TFVTPERSYKQ----HTQRPSESVYMSPGP------- 396
gi 655870398  336 PIRGDT---EVSRKVTISPG-QSvplTHRATTRTVSEGPHKSsMFVTPEHVYKE----QSQRPAETNYMSPGPTLRYQ-- 405
gi 351706635  322 SIRDN----EVSCRVTMSSPRQSvqsTLHPTARAVPDSPRKSlMYVTPESIHKQ----QIQRPAETNYMYSGPAVRYP-- 391
gi 348562518  323 SIRDN----KVSHRVTKPSGGQSvqsTLRATARVVSESPRKShLYAMPVSTHKQ----QTQRPAETNYMSPGPAIRYP-- 392
gi 532072335  332 PIRDSEvgrEISRKATISPQRQS---TQRVTSRAGSEGPHKSlVFVTPEPVHKQ----QMQRPPETIYVSPGPALRYQ-- 402
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 928144893  404 ----EP-SQKPSVHAELE---------------------------------------LTPRPLPPRSLPRYGPDSSWWTL 439
gi 982955990  399 ----EPsSRKHSVRVELE---------------------------------------LTPRPLPPRCLPRYGPDSTWWAL 435
gi 620964848  459 qletEA-SRRATVQLEMEapwgtvvrpesgpslggppaqsafgsspgpvgylepipeFTPRPLPPRALPRYGPESPWWAL 537
gi 967048856  406 ----EL-SQKPSIHAELE---------------------------------------LTPRPLPPRSLPRYGPDSSWWPL 441
gi 831235493  400 ----EP-SRKPYSHPEVE---------------------------------------LTPRPLPPRSLPRYEPDSSWWYL 435
gi 545858915  403 ----EP-SGKPSVHAELE---------------------------------------LTPRPLPPRSLPRYGPDCSWWAL 438
gi 511845873  397 -------SQKPSVHAELE---------------------------------------LTPRPLPPRSLPRYGPDSSWWTL 430
gi 655870398  406 ----ES-SQKPPIHAELE---------------------------------------LTPRPLPPRSLPKYGPESSWWGL 441
gi 351706635  392 ----EP-SRKPSIHAELE---------------------------------------LTPWPLAPRSLPKYGPDSSWWAL 427
gi 348562518  393 ----EP-LQKPSTHAELE---------------------------------------LTPRPLPPRSLPKYGPDSSWWAL 428
gi 532072335  403 ----EP-SRKPSIHAEVE---------------------------------------LTPRPLPPRSLPRYGPDSSWWAL 438
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 928144893  440 LNPEVETP-QSRPTT---------PDFESKS---PP-----PSDPLLSCFEMDLSPFCEEMMFQREKASPSPPLApatpp 501
gi 982955990  436 LSPDGEMP-NSRPTT---------PDIEPKS---PP-----PPDPSLPFFEMETSPFCEDLMFQREKASPSPLSS----- 492
gi 620964848  538 LNPEAGSPsRSRPGAsppraevefPDPEPETgttPPaaetsPADPFVTRIDVALDPLCEELALPRE--DPAVPPSq---- 611
gi 967048856  442 LNPEVETP-QSQPTT---------PDFELKC---SP-----SLDPLLSGFKIDSSPFCEDLKFQREKASLSPPSP----- 498
gi 831235493  436 LNPQVETP-QSQPTT---------PDLEPKS---PP-----PLDPLLTFLKMDSQPFCEDCMFQREKASPPPPPT----- 492
gi 545858915  439 LNPEIEMP-QSWSTT---------PDFEPKS---PS-----PLDPSLPFFEMDSSPFCEDLMFPRGRASPSPPPApaasp 500
gi 511845873  431 LSPEVETP-QSRPTT---------PDFESES---PP-----PPDPLLSFFEMDSNPFCEEMMFQREKASPSPPPApatpp 492
gi 655870398  442 LNPEAEIS-QSWPTT---------PDFEPKP---SP-----PLDPFMSLLEMNSSPFCEDLTFQREKAsppppppp---- 499
gi 351706635  428 LNPQVEMP-QSLSTT---------LDFEPKS---PL-----LLDTSESLYEMDSIPFCEDLIFQREKASPRLPRS----- 484
gi 348562518  429 LNPQVEMP-QSRPTT---------PDFEPKS---PP-----PIDTLRSLYEMDSIPFCEDLIFQRQKASPPLPSS----- 485
gi 532072335  439 LNPEVEIP-QSRPTT---------PDFEPKS---PP-----PLDPLVSLFEMDSSPFYEDLMFQREKASPPSPPS----- 495
                         650       660       670       680       690       700
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 928144893  502 ---prssPKESPNRA-PLR---EAPQAL-------KCTSKQPIQRFSAFFLDVSEEMYNRVIWWL 552
gi 982955990  493 -------PKESPSPS-PLR---EVLQAP-------KHTSRHPTQRFSVFFMDVSEEMYNRVFWWL 539
gi 620964848  612 -------PKRPSGLA-KPRdalRIPGCPserigpvRVARKESVPRFSAFFLDVSEEMYSRVIWWL 668
gi 967048856  499 -------PKEFPSWA-PLN---KVPQTP-------KHTCKQPIQRFSAFFLDVSEEMYNRVIWWL 545
gi 831235493  493 -------PKDFPSQAsSLR---EVPQAT-------KYTSKQPIQRFSAFFLDVSEEMYNRVIWWL 540
gi 545858915  501 sppppplPKESPSRA-PSR---DVPQAP-------KHASKQPIQRFSAFFLDVSEEMYNRVIWWL 554
gi 511845873  493 ---plslPKESLNQA-LLS---EVPQAF-------KCTCKQPIERFSAFFVDVSEEMYTRVICWL 543
gi 655870398  500 ppppppppKESPSWA-PMR---EVPKAP-------KHTCKQPIQRFSAFFLDVSEEMCNRVIWWL 553
gi 351706635  485 -------PKESSSQL-PLR---EVPQDP-------KYTNKQLSQRFNAFFLDVSEEMQNRIIWWL 531
gi 348562518  486 -------LKVSSSQS-PLT---ELPQDF-------KHTCKQLNQRFNAFFLDVSEEMQNRIIWWL 532
gi 532072335  496 -------PKESPGRV-PLR---EVPQAP-------KHTIKQPIQRFNAFFLDVSEEMQNRIIWWL 542
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap