Conserved Protein Domain Family
Draxin

?
pfam15550: Draxin 
Draxin
This family of proteins inhibit Wnt signaling and act as chemorepulsive axon guidance molecules.
Statistics
?
PSSM-Id: 317884
View PSSM: pfam15550
Aligned: 12 rows
Threshold Bit Score: 399.2
Threshold Setting Gi: 597732464
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81892395    40 THSHLPSSALWVSQAShhgrrgL---GKKDRGPGrPS----------RAQEGAVVTATKQASQMTLg------QPpag-- 98
4_pfamImport    1 NGLQHPLRGLQGHRHG------GgqgARAAKAGA-GLlsrrplhplaRPGDDGTGLEGLSPVRLET-------GPrd--- 63
11_pfamImport   4 NTLQGPELWP--QRSGhhrrhgG----RKDKASA-GLlsrgpppsmgRPEDDGTGLEGLSPVRLEL-------GPeerrg 69
7_pfamImport    4 NKLQTPQVWPHRHRSGhhrkqgL---AKRERANA--MllrgpgprkvDLED--PGIESLTPVRLEM-------DGprrss 69
3_pfamImport    4 NSQYDQALWPHQTQGRnhrrsqM---SKKDR-----TlgalptpallPSEE--AIGSSLWRVAGET-------GQpsa-- 64
9_pfamImport    4 NHLQNQEMWLQQPRSGhhhkhgL---AKKERAHAmPPrgqlaveealRPGSGASAVEEPAP------------GQpaa-- 66
6_pfamImport    4 NNINRQSPELWRARARhsrrhgP---SKKGRAHVpGPagasglpgmlRAGDAPAV------------------QGpag-- 60
5_pfamImport    4 NHIDLPRPALWTPQAGhhrrrgL---GKKVRGPGmPG----------RAQDGAVVTTTRQASRLPGvggllpgQSpag-- 68
8_pfamImport    3 NALQYPGQVLQSQSHGrdrrghGsqrSRYAKGEA-GIlshrglhplpRLGDEETGLEGLNPVRVEM-------GP----- 69
gi 688611813   37 NIIIPPKPEASIHHHThqrtdrG----RK-ERMTaGQlrerpriaifHTQNEGPDLEGLSPVRLEM-------EPadkrr 104
gi 688576790   41 TSKEHPETGL---TGGrqqkrhW---SGK-ERDSaGLfsqr---hmdRLEDDGTSMEGLSPVRLEM-------GPgd--- 100
gi 597732464   44 NTLQDPEAAL--HHGGhrr--------------rqGVlshrplqtaaRPEDDGTGLEGLSPVRLEM-------GPg---- 96
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81892395    99 -llQNKELLLGLTLPYPEKEARsp-awE-----RVKK--RG------REHKR---RRDRLRLHRGRAAIR--GP------ 152
4_pfamImport   64 --rDRDRVRASAKGLSPTRENQ-----LllgtrKGRR--HGnghghhFGDRRqagRRDKERHGKGFLAAP--EL------ 126
11_pfamImport  70 ssqERDTGFLGFGTPFHERDNRpp-gsEgt--gKGRR--HGh----hLEHRKhggRKDKARQVKARLSEP--EL------ 132
7_pfamImport   70 alqEEKEEFLGFDFPYPGRDNEpp-gsEsi--lKGRK--HS------REHRKl-nRKDRLRHQKGKQRPP--YS------ 129
3_pfamImport   65 -lkQNRDELQTFHLSYNQRVNQ-----QvdikaKRKK--HN------RDQKKs-sMKDHVRHHRGRGFEV--EP------ 121
9_pfamImport   67 -lkQDKDVFLGFEFPHPERENQsp-gsE-----RGKK--QS------REHRRh-sRRDRLKHHRGKTPDA--GP------ 122
6_pfamImport   61 -llRDKDVFLGFEFPYSERDNQf----E-----RGRK--HG------REHKR---RRDRAKQQRGRSLDP--KP------ 111
5_pfamImport   69 -llRDKDLFLGLAPPYPEKENRsp-glE-----RAKK--HD------REHKR---RRDRLKLHRGRALVR--GP------ 122
8_pfamImport   70 ---SRDRARQSAKSSSQNQESKnq-enQlvgirKVRG--HGnghrhlFENKKqgsRRDKVRHKKGFPSGP--EA------ 135
gi 688611813  105 vmtPRKKTFMGSDSLIQEKMNIsp-gaE-------------------TPEKAm--RRPTVRKVFGGHITR--APheeesl 160
gi 688576790  101 --tMKAEVHGEVRASAQMRQGShpaegEln--rKGRR--HShr--llAEHRKhggKKDK---GRGDLSDP--EPe----l 163
gi 597732464   97 ---ERERGHGGVRGHSHMRDNHpp-ggEfs--rKGRRngHQ------PEHRRh-gRRDKTR-GKGFFPDPnaEL------ 156
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81892395   153 SSLMKKVEPSEDRMLEGT------------M-------E-------ESSTSLAPTMFFLTm-TDGATPTTEESRILPVTS 205
4_pfamImport  127 SSAFKDGDLFEDPFSSSSlsm-------tpP-------G-------DAPSPIAAVFGSGS--SMVTTVMNEHPPTLPPAS 183
11_pfamImport 133 GSVLKEGEQFEEQLPSKPpses-----aapP-------T-------AFPSPTPGN--AHSt-ALVPTVISEDAPAPPPAS 190
7_pfamImport  130 EVALLDRDAFKNCLTPCI------------------------------KTLLSPSLSFLYi-AD------------PPPS 166
3_pfamImport  122 SGLLKEDLTFKGPTQYTYldmfsggptamlP-------Q-------STANPM---------------FINEQPTAVLQTA 172
9_pfamImport  123 SSLYKKPESFEEQFQNLQ--------------------A-------EDATSLTPTTLLFT--ALELVVSTDEPPVLPATS 173
6_pfamImport  112 SSLFKKAEVSEDLAPYGP------------M-------E-------ESSTSLAPTILFLT--TFETAASTEESPVLPVTS 163
5_pfamImport  123 SSLMKKAEFSEDQAQDAT------------M-------E-------ESSTSLAPTLLFLT--TLEAAPATEESLILPVTS 174
8_pfamImport  136 SSAFKDRDQFEDPPPSSSspstspflgvtpP-------S-------EPPSPIDSLFDSDS--SMVTMATNEHPPTRPPGS 199
gi 688611813  161 ASGKKRRVSFDQRLNKAS-----------------------------FGSPTEPVLPA-AtvGTFILPITAAVDGNPNPS 210
gi 688576790  164 DSLLKDLNAFEDGLNTSP------------P-------NynsvplnEVPSPLSPIL--------VTTAIKGHPPTLPPAS 216
gi 597732464  157 GSLIKDFDALDDAPFTPS------------PnhdaavaA-------EAPSPASRI--------PVATVMSEHPPTLPPAS 209
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81892395   206 LRP--------------QT-QprSDGEVMPTLDMALFDWTDYEDLKP-EVWPSAKKK--EKHWSHFTSDG--NETSPAE- 264
4_pfamImport  184 TKPq------------rSG-RvkGQGDVMPTLDMALFDWTDYEDMKPvDAWPSSRKK--DKRRSKNLSSG--NATVDAD- 245
11_pfamImport 191 TKPqk----------lsQG-RmrSEGEVMPTLDMALFDWTDYEDMKPvDTWPSSKKK--EKRRSKNLSSS--NMTADTD- 254
7_pfamImport  167 KYLefilal--lvfhifQA-RvkADGDVMPTLDMALFDWTDYEDLKP-EMWPSVKKK--EKRRSKSLSIG--NLTSLAE- 237
3_pfamImport  173 RRM--------------RT-HvkKGGDVMPTLDMTLFDWTDYEDMKP-EIWPSSKKK--GKYRCKNKENP--NNATLSV- 231
9_pfamImport  174 PRS--------------QA-RlrQDGDVMPTLDMALFDWTDYEDLKP-EMWPSAKKK--EKRRSKSPSSG--NETVSSE- 232
6_pfamImport  164 PRPl-------------KA-RirPEGDVMPTLDMALFDWTDYEDLKP-DMWPSAKKK--EKFQSKSPDYG--NETSATQ- 223
5_pfamImport  175 LQPq-------------QV-QprPDGEVMPTLDMALFDWTDYEDLKP-EVWPSAKKK--EKHWSKLSSGG--NETSPAE- 234
8_pfamImport  200 AKPq------------kSG-Q--GQGEVMPTLDMTLFDWTDYEDMKPvDSWPSSRKK--DKRRSKNLSSG--NLTADVD- 259
gi 688611813  211 SEP--------------QV-RryLGGDVAPTFNMALFDWTDYEDMRPgDKKQYSKKQgsEKQATQSPSTGlvRLTSENN- 274
gi 688576790  217 TKPqvpwqveatlnikkSS-QgrTQGEVMPTLDMTLFDWTDYEDMKPaDSWPSNKRK--DKRRSKNKSNG--NTTTEAGi 291
gi 597732464  210 TKPq-------------RAsRgkGQGEVQPTLDMALFDWTDYEDMRPvDNWPSNKKK----------------------- 253
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81892395   265 G--DPCDHHQDCLPGTCCDLREHLCTPHNRGLNNKCFDDCMCMEGLRCYAKFHRNRRVTRRKGRCVEPETANGDQGSFIN 342
4_pfamImport  246 Ai-EPCDHHLDCLPGSCCDLRQHECKPHNRGLNNKCYDDCMCEEGFRCYAKFHRKRRVTRRKGRCVVPESVSSDQGGFIT 324
11_pfamImport 255 AqaEPCDHHLDCLPGSCCDLRQHVCKPHNRGLNNKCYDDCMCEEGLRCYAKFHRNRRVTRRRGRCVDPESVNSDQGSFIT 334
7_pfamImport  238 P--EPCDHHLDCLPGNCCDLRQHVCKPHNRGLNNKCFDDCMCAEGFRCYAKFHRNRRVTRRKGRCVEPDTVSNDQGSFIT 315
3_pfamImport  232 E--EPCDHHLDCLPGSCCDLREHLCKPNNRGLNNKCYDDCMCTEGLRCYAKFHRNQRVTRRKGRCVDPETINKDQGSFIS 309
9_pfamImport  233 G--EPCDHHLDCLPGSCCDLREHLCKPHNRGLNNKCYDDCMCTEGLRCYAKFHRNRRVTRRKGRCVEPESANGEQGSFIN 310
6_pfamImport  224 E--EPCDHHLDCPPGSCCDLREHLCKPHNRGLNNKCFDDCMCMEGLRCYAKFHRNRRVTRRKGRCVEPESINGDQGSFIN 301
5_pfamImport  235 G--EPCDHHQDCLPGSCCDLREHLCTPHNRGLNNKCFDDCMCVEGLRCYAKFHRNRRVTRRKGRCVEPETANGDQGSFIN 312
8_pfamImport  260 Ai-EPCDHHLDCLPGSCCDLRQHECKPHNRGLNNKCYDDCMCEEGFRCYAKFHRKRRVTRRRGRCVVPESVSNDHGGFIT 338
gi 688611813  275 V----CKHHLDCLPGSCCNLRKHVCELHNRGFNNKCYDSCMCEEGLRCYAKSHRHYRITRKKGQCVDPEDLN--HGMFII 348
gi 688576790  292 V--EPCDHHLDCLSGSCCDLREFECKPHNRGLNNKCFDDCMCEEGLRCYAKFHRKRRVTRRRGRCVDPESVNSNQGAFIT 369
gi 597732464  254 ----------DIPIGSCCDLRQHECKLHNRGLNNKCYDDCMCEEGLRCYAKFHRKRRVTRRRGRCVEPDSADGDQGAFIT 323

                  .
gi 81892395   343 I 343
4_pfamImport  325 I 325
11_pfamImport 335 I 335
7_pfamImport  316 V 316
3_pfamImport  310 I 310
9_pfamImport  311 V 311
6_pfamImport  302 V 302
5_pfamImport  313 V 313
8_pfamImport  339 I 339
gi 688611813  349 V 349
gi 688576790  370 V 370
gi 597732464  324 I 324
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap