Conserved Protein Domain Family
DUF4656

?
pfam15551: DUF4656 
Domain of unknown function (DUF4656)
This family of proteins is found in eukaryotes. Proteins in this family are typically between 286 and 398 amino acids in length.
Statistics
?
PSSM-Id: 317885
View PSSM: pfam15551
Aligned: 5 rows
Threshold Bit Score: 494.873
Threshold Setting Gi: 972974876
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 478503084  48 KDPGHHGPESLTFISGSAEPAAEPPACCLLwRPWVWDWCQAAFCfrrcrgCLQRCGACVRGCGPCLSAGDSPEGAAEASW 127
gi 149694193  48 KDPGHHGPESLTFISGSAEPAAEPPACCLLwRPWVWDWCRAAFCfrhcrgCLQRCGACVRGCSPCLSAGDSPEGAAEASW 127
gi 972974876  74 RDANGRESETIGFIPGSADNPPSTQTCGSC-SSLGWSSCRALIC------CIFSCGFYKTEPSVYIPCLDRNETSTEDVK 146
gi 327285564  66 KDPNGREGETITFISGPADPP--QSACCPS-FSQAWSAYKAIFC------CIVTCGGCFRDCKPKIPYP-YIETLTEDVK 135
gi 224081634  69 KDPNGREAETITFISGTAEAPPNQSFCCSS-LSQAWNTYKAVFC------CIVTCGGCFQDCSVCIPYPGPAETSTEDGK 141
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 478503084 128 AKE----HNGVPP-SPDRAPPSRRDGQ-RLKTTMGSSFSYPDVKLKGIPVYPYRsATSPAPDVDSCCKEPLAEPPPMRHS 201
gi 149694193 128 AKE----HNGVPP-SPDHAPPSRRDGQ-RLKTTMGSSFSYPDVKLKGIPVYRYRpATSPAPDVDSCCKEPLAEPPPMRHS 201
gi 972974876 147 SSQepkrPNGLALsNPTSGISLETKHS---KPPLSDSFNYPDIKFKGERVKL----------------EGRVNAPKRTPS 207
gi 327285564 136 GQE----CNGRSPtSPTSGSPAEKNGNpTKKSTVGSSFSYTDIKLKGVPVFPNR-SPSSHTDTDSCYKEPLPE-KISWPS 209
gi 224081634 142 NGD----YNGRLPnSPTNTSPAEKNGNqIKKSSMGSSFSYPDVKLKGIPVYPNR-NTNHHPESDSCCKELLEK-PFRNSI 215
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 478503084 202 LPSTLASSPRGSEEYYSFHESDLDLPEIGSGSMSSREIDVLIFKKLTELFSVHQIDELAKCTSDTVFLEKTSKISDLISS 281
gi 149694193 202 LPSTLASSPRGSEEYYSFHESDLDLPEIGSGSMSSREIDVLIFKKLTELFSVHQIDELAKCTSDTVFLEKTSKISDLISS 281
gi 972974876 208 SKSVQKGDTLRPSSSYSLEDPD---QYLDDLSDCSTDIDSLITKKLLELYKLHQIDQLAKCTSDSVFFRKTSEITELINN 284
gi 327285564 210 QKQHPPSSHRSSEEHYSFHESDFEFGEL-NSSMSSREIDVLIFRKLTELFSVHQIDELAKCTSDTVFLEKTNKISDLINS 288
gi 224081634 216 EKPPLPSSHRSSEEYYSFHESDVDISEL-NGSMSSRQIDVLIFKKLTELFSVHQIDELAKCTSDTVFLEKTNKISDLINS 294
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 478503084 282 ITQDYHLDEQDAEGRLVRGIIRISTRKS-RTRPQ-------T-----------TEGRSTR----AaasaVAAPDSGHETM 338
gi 149694193 282 ITQDYHLDEQDAEGRLVRGIIRISTRKS-RTRPQ-------T-----------TEGRSTRaaasA----AAAPDSGHETM 338
gi 972974876 285 IAQDYNLDEQDAECRLVHGVIRISTRKSkRAAPQksd-saySsgshsrepghrAEDRGRR----D----GTLPDSGNDTL 355
gi 327285564 289 ITQDYHLDEQDAECRLVRGIIRISTRKS-RVRPRvciptlpS-----------QEENSTR---------GNPPDSGNETM 347
gi 224081634 295 ITQDYNLDEQDAECRLVRGIIRISTRKS-RVRPHipl-psqS-----------HEEKSGR---------GNAPDSGNETM 352
                        330       340       350       360       370       380
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 478503084 339 MGSGL-SQD-ELTVQISQETTADAIARKLR--PYGAPGF----PASHDSSFQGTDTDSSGAPLLQVYC 398
gi 149694193 339 VGSGL-SQD-ELTVQISQETTADAIARKLR--PYGAPGY----PTSHDSSFQGTDTDSSGAPLLQVYC 398
gi 972974876 356 IETSLtSQEtDLDVKISEQTSSDKLARQMR--HSSSQGYssncPTGNYASFPDAETNSSGTPLLDKYf 421
gi 327285564 348 VASVLtSEE-DLSVKISVETTADVKARYMRhgPYSVTGS----PLSRGSSYQDTETDSSGAPLLKAYC 410
gi 224081634 353 LESMViSQD-ELAVQISEETPADVLARNMR--RHSSAGS----PTSRDSSFQDTETDSSGAPLLQVYC 413
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap