Conserved Protein Domain Family
Zwint

?
pfam15556: Zwint 
ZW10 interactor
This family of proteins is found in eukaryotes. Proteins in this family are typically between 127 and 281 amino acids in length.
Statistics
?
PSSM-Id: 317890
View PSSM: pfam15556
Aligned: 7 rows
Threshold Bit Score: 324.246
Threshold Setting Gi: 395820951
Created: 31-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115312040  29 QEEAELPAQILAEFVMDSRkK-DKLLCSQLQVVDFLQNFLVQEGTAQDQNPLASEDTSRQKALEAKEQWKELKATYQEHV 107
gi 946760391  31 QEEAEVPGQILAEFVMDSR-KkDKLLCSQLQVVDFLQNFLAQEDIVQGLDPLASEDRSRQKAIAAKEQWKELKATYQEHV 109
gi 395820951  29 QEESELPAQILAEFMMDSQkK-DRLLCSQLQVVDFLQNFLAQENPTQGLDPLASEDLSRQKAIAAKEQWKELKATYRQHV 107
gi 395741768  29 QEEAELPAKILVEFVVDSQkK-DKLLCSQLQVVDFLQNILAQDDTAKGLDPLASEDTSRQKAIAAKEQWKELKATYREHV 107
gi 752420796  29 QEEAELPAQILAEFVMDSRkK-DKLLCSQLQVVDFLQNFLAQEDVVQELDPLASEDISRQKALAAKEQWKELKATYQEYV 107
gi 587004028  29 QEEAELPAQLLAEFVMDSRkK-DKLLCSQLQVVDFLQNFLAREDTAQGPEPLASEDASRQKAVAAKEQWKELKATYQEHV 107
gi 545193796  29 QEEAEVPAQILAEFVTDSRkK-DKLLCSQLQVVDFLQNFLAQEDTAQGLDPLASEDTSRQKAIAAKEQWKELKATYQEHV 107
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115312040 108 EVITNSLTEALPKVEEAQIKQAQLQEALKQLQAKKQMAMEKLRIAQKQWQLEQEKHLQNLAEASSEVRERQTGAQQELQR 187
gi 946760391 110 EAISRALIQAMPKMEEAQRKQAQLREALEQLQAKKQVAMEKLRTAQKQWKLQQEKRLQHLAEVSAEVRQRQAGTQQELEQ 189
gi 395820951 108 EAIKSVLTQALTREEEVHRKRTQLQEAHEQLKAKKQMAAEKFRAAQKQRQLQQEKHLQHLGEVSTEVKKRQSETQQELER 187
gi 395741768 108 EAIKIGLTKALTQMEEAQRKRTQLQEAFEQLQAKKQMAMEKRRAAQNQWQLQQEKHLQHLAEVSAEVRERKTGTQQELEG 187
gi 752420796 108 EAITGALTQALPMMEEAQRKRVQLQGALEQLQAKKQVAMERLRTAQKQWQLQQEKHLQHLAEASAEVRQRQRGTQQELER 187
gi 587004028 108 EAITRALSLALPRMEEAQRKRAQLQEALEQLQAKKQAAMEKLRTAQEQWRLHQEKRLQQLAEASAEVRLRQTGAQQELQR 187
gi 545193796 108 EAITSALTQVLPKVEEAQRKRAQLQEALEQLQAKKQVAAEKLRVAQKQWQLQQEKHLQHLAEVSAEVRERQTGMKQELER 187
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115312040 188 LYQELGTLKQQAGQEKDKLQRHQTFLQLLYTLQGKQLFNEAEAEIPQE--------LDLPKDKLQQVTQPQEQNTQDTMG 259
gi 946760391 190 LYQELGTLKQQAGQERDKLQRHQTFLQLLYTLQGQLQSPETEAELPQD--------LGLPEDKSQLLTQSREQTRGDTMG 261
gi 395820951 188 LKKELDILKQQAGREQDKLQKYQTFLQLQCTLQGKPLFPEAEIEAEakmpqelpvhlELPEDKTQLPTQPQEQNTGDR-E 266
gi 395741768 188 VFQKLGNLKQQAEQERDKLQRYQTFLQLVYTLQGKLLFPEAEAEAE-----------NLPDDKPQQLTRPQEQSTGDTMG 256
gi 752420796 188 LSQELGSLQQQAGQKRDTLQRHQTFLQLLHTLQGQLPFPEAETELPQR--------LDLPEDK------PQKQNPGDTIG 253
gi 587004028 188 LHQELGALRQQAGQERDRLQRHQTFLQLLHTLQGQLPFPEAETEPPRK--------LDPAEDE------PQRRNTGDAVG 253
gi 545193796 188 LYQELGTLKQEAGQEREKLQRHQTFLQLLYTLQGKLLLPEAEAELPQE--------RDLPEPKSQQVTQSWELNTGDTME 259

                 .
gi 115312040 260 R 260
gi 946760391 262 R 262
gi 395820951 267 K 267
gi 395741768 257 R 257
gi 752420796 254 K 254
gi 587004028 254 R 254
gi 545193796 260 R 260
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap