Conserved Protein Domain Family
CAF1-p150_N

?
pfam15557: CAF1-p150_N 
CAF1 complex subunit p150, region binding to PCNA
CAF1-p150_N is part of the N-terminus of the CAF1 complex p150 subunit that binds to PCNA - proliferating cell nuclear antigen. The PCNA mediates the connection between CAF-1 and the DNA replication fork. The CAF1 complex is essential in human cells for the de novo deposition of histones H3 and H4 at the DNA replication fork.
Statistics
?
PSSM-Id: 317891
View PSSM: pfam15557
Aligned: 8 rows
Threshold Bit Score: 350.356
Threshold Setting Gi: 348549984
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 229621701    1 MLEEPECGAPGARGEAAAMDCKDRPAFPVKKLIQARLPFKRLNLVPKEKIDDGLDDTGGSragpVQTQLHNLETSLDHLE 80
gi 229462842    1 MLEELECGAPGARGAATAMDCKDRPAFPVKKLIQARLPFKRLNLVPKGKADDMSDDQGTS----VQSKSPDLEASLDTLE 76
gi 156120333    1 MLEEPECGAPGARGEAAAMDCKDRPAFPVKKLIQARLPFKRLNLVPKEKIDDGLDDTGGSragpVQTQLHNLETSLDHLE 80
gi 348549984    1 MLEEPECAAPGARGSAPAMECKDRPSFPVKKLIQARLPFKRLNVVHKEKATDESDD-RMAqgtsVAENVATLKASLDILE 79
gi 395831689    1 MLEEPECVAPGAREAAVAMDCKDRPAFPVKKLIQARLPFKPLNLVPKEKA----DDVRSCqsasVQSTVPDS----DTLE 72
gi 511904046  103 MLEELECGAPGARGAAAAMDCKDRPAFPVKKLIQARLPFKRLNLVPKEKSEDGSDDTRSSegtpAQSQVPDLETSLDTVE 182
gi 311248398    1 MLEEPECGAPGARGAAAAMDCKDRPAFPVKKLIQARLPFKRLNLVPKEKTDFGLDNTGGSqsapVQSQVPDLETSLEHLE 80
gi 940778556   84 MLEEPECGAPGARGAAAVMDCKDRPAFPVKKLIQARLPFKRLNLAPKEKTEDGADSTGSSpsapAQSQVPDVETSLDNLE 163
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 229621701   81 -NCHMGSDIDFRPKLVNGKGPLDNFLRSQVETSIGQAVVIIDLTEDSSNPPDNMVGHNKLNSAASSA-QKNINGVPDKAG 158
gi 229462842   77 nNCHVGSDIDFRPKLVNGKGPLDNFLRNRIETSIGQSTVIIDLTEDSNEQPDSLVDHNKLNSEASPS-REAINGQREDTG 155
gi 156120333   81 -NCHMGSDIDFRPKLVNGKGPLDNFLRSQVETSIGQAVVIIDLTEDSSNPPDNMVGHNKLNSAASSA-QKNINGVPDKAG 158
gi 348549984   80 nDCPVDSEQDFTPKLINGKGPLDSFLSSEVKSGLGQHMVTIDLTEDSNEQPERTVTPGPLSTSASLP-REAVNGLGEEAA 158
gi 395831689   73 nNCLIGSDVDFRQKLVNGKSPLDNCVGSSIKTSIGQSSVIIDLTEDSDEQPDSPTHHSRLNPEASPP-REAVNGDREEAA 151
gi 511904046  183 nNCHMGSDIDCSPKLVNGKGPLDNFLRNRVKTNIDQTAVIIDLTEDSSDQLDGLVAHSKLDAAASPS-EEAVSGVREEAG 261
gi 311248398   81 nNCHMGSDIDFSPKLVNGKGPLDSFLRSQVETSVDQSVVIIDLSEDSSDPPDSTAGHSKLNSAAFPS-QENVNGVTEEAG 159
gi 940778556  164 nNFHMGSDIDFRPKLVNGKGPLDNFLKSRVKTSIGETTVIIDLTEDSSDQPDNISAYNKLNSAACPSlEEAVNRVREEAG 243
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 229621701  159 DDRGLPKARQKDELASPEEALSEVPCKTEAGGA--DSGGADRRGLTQRGSPQNCPKLTGDLSMWSEKDRDGWS 229
gi 229462842  156 DQQGLLKAIQNDKLAFPGETLSDIPCKTEEEGV--GCGGAGRRGDSQECSPRSCPELTSGPRMCPRKEQDSWS 226
gi 156120333  159 DDRGLPKARQKDELASPEEALSEVPCKTEAGGA--DSGGADRRGLTQRGSPQNCPKLTGDLSMWSEKDRDGWS 229
gi 348549984  159 -EKGPLKVIHSDKLGLPEETLSDIPCQTEEELG--GSGGPDGQG---------CPTLPSCASVCPQVGRDAWS 219
gi 395831689  152 DQ----QAIQSHKLTFLEETLSDIPCKTEEDGVvfEGRGAERSGNSLECSPRSCPKLTCGLRSCLEKEWYSWS 220
gi 511904046  262 GDRGPPEASPEDELACSEETLSDIPCKTEKEGP--GSGGPERSGDGQKGSPPSCPVPTGDARMCPEKDQDGWS 332
gi 311248398  160 DDRGLPKASQKDRLAFPEEALSAIPCEAEERDI--DSGGAERSELVQKASPQCCPELPGGLRTHSKKEQDGWS 230
gi 940778556  244 DEGGLPKAsqkdeltfseETLLDIPCKTEEEGT--GSGGTERRGDAQEAS-QSCPKLTDGPRTCSEKDQDSWS 313
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap