Conserved Protein Domain Family
DUF4662

?
pfam15578: DUF4662 
Domain of unknown function (DUF4662)
This family of proteins is found in eukaryotes. Proteins in this family are approximately 290 amino acids in length.
Statistics
?
PSSM-Id: 317903
View PSSM: pfam15578
Aligned: 9 rows
Threshold Bit Score: 409.29
Threshold Setting Gi: 612015137
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74739697     2 HPINVRRDPSIPIYGLRQSILLNTRLQDCYVDSPALTNIWMARTCAKQNInAPAPATTSSWEVVRNPLIASSFSLVKLVL 81
gi 612015139    2 HPIYMRRNSGIPTYGLRQSILVNKRLQDCYVDTPTLTNIWTSKTYANPSV-ASKGGLTSSWEVVKNPLVSSSFSLVKLVL 80
gi 612015137    9 HPIYMRRNSGIPTYGLRQSILVNKRLQDCYVDTPTLTNIWTSKTYANPSV-ASKGGLTSSWEVVKNPLVSSSFSLVKLVL 87
gi 1040115737  31 HPIYVRRDPSLLTYGLRQCILLNTRFQDCYVDSPALTSNW-----ANQNIdAPAPGTASCWEVVQDPLIVSSFSLVKLVL 105
gi 884939450    1 ----------MATYGLRQSILLNTRLQDCYVLSPALTNIWMARMCAKQNIqAPTSGTASCWEVVKSPLITSSFSLVKLVL 70
gi 545544333    2 HPIYVRREPSIPTYGLRRSILLNTRLQDCYVDARALASPWVARVCAEQNIrSPAPGTTSSWEVVKNPFIASSVSLIKLVL 81
gi 940758769    1 ----MRRDPSIPTYGLRQSILLNSRLQDCYVDSPALTNIWTPRTCAKRTIsAPAPGTTSSWEVVKNPFITSSLSLVKLVL 76
gi 545869420    2 nPLYMRRDPSIPTYGLRQSILLNTRLQDCYVDSPALTNIWTTRTCAKQNIgAPMPGTTSSWEVVKNPLIASSFSLVKLVL 81
gi 155372209    2 HPIYVRRDPSIPAYGLRQSILLNTRLQDCYVDSPALTNIWTTRTCAEPNTtAPTPGPTSSWEVVKEPVIASSFSLVKLVL 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74739697    82 RRQLKNKCCPPPCKFG-EGKLSK--RLKHKDDSVMKATQQARKRNFISSKSKQPAGH---------RRPAGGIRESKESS 149
gi 612015139   81 RRQLKDKCCPIPPKLGaEGKARKipKIKTKGTGPVRADPGDRDTEAVPDKDKSPSGKpsgt--sdlMRSTGPDSESEESQ 158
gi 612015137   88 RRQLKDKCCPIPPKLGaEGKARKipKIKTKGTGPVRADPGDRDTEAVPDKDKSPSGKpsgt--sdlMRSTGPDSESEESQ 165
gi 1040115737 106 RRQLEDKRFPVPCKLG-EAKPRK--RLKPKDNSVTKVTPRVRIRNSIRSRSKQPAEQlpss--pgcRRPAGGIGESKESS 180
gi 884939450   71 RRQLKDKCCSVPSRFG-EAKSLK--RLRSTDNSTTKATPLARISSSINFKSRRQVGQvpgs--pghRRPAGSIRKRKESS 145
gi 545544333   82 RRQLKDKCCPGPRKFG-EAKPSK--RLKPKDNSATKATQRGRVRNPITSKGKGPVGQrpgspsprlRKPAGGISKSKESS 158
gi 940758769   77 RRRLKDQCCPVPCKFG-EAKPSK--LVEPKDDSATKATRRGRMRNSISSQSKQPLGQqpgs--prrRRPAGSNNESKESS 151
gi 545869420   82 RRQLKEKCCPVSRKFR-DVKPLK--RLKPKEVSVMKAVQRGRIRNPISSKGKRPVGQqpgs--prcRRPSGDIHESKESS 156
gi 155372209   82 RRQLKEKCCPVPRKFG-DAKPSK--RLKPRDDATMKTTQQGGTRNSISCKSKQPAGQrpgs--lrrRKPAGGV-ESKESS 155
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74739697   150 KEKK-LTVRQDLEDRyaehvAATQALPQDSGTAAWKGRVLLPETQKRQQlSEDTLTIHGLPTEGYQALYHAVVEPMLWNP 228
gi 612015139  159 KEEKeAAVGEDLQEG-----AVTQIPLGKSEGPVGETQVDLPLGNRGEP-PQDTLIIHGLSAEQYTALYHSVVEPMLWNT 232
gi 612015137  166 KEEKeAAVGEDLQEG-----AVTQIPLGKSEGPVGETQVDLPLGNRGEP-PQDTLIIHGLSAEQYTALYHSVVEPMLWNT 239
gi 1040115737 181 KQKK-AAVRQDLLDRyaehvAATQVLPRDSRTAAWKGWALLPETQRRLPpSEDTLTIHGLPAEGYRALYHAVVEPLLWNP 259
gi 884939450  146 KEKK-VTASQDLEDRydkhvAATQPLPRDSELTAWKGQASLPETQKRQQlSEDALTIHGLPTEGYKALYHAVVEPMLWNP 224
gi 545544333  159 KEKK-VTVRQDLESRyaehvAATQALPGDTGTAAWKGQALLPETRKRQQlSEDKLTIHGLPMESYRALYHSVVEPMLWNP 237
gi 940758769  152 KEEK-GTVSQDLESRyaehvAATQALRRDMGTAAWKGQALLPEARKRQPlS-DMLTIHGLPTEGYRALYHAVVEPMLWNP 229
gi 545869420  157 KEKK-VTVCQDLESRyaehvAATQGLPRDIGTASWKGRALLPETRKQQPlSEDTLTIHGLPTEGYRALYHAVVEPMLWNP 235
gi 155372209  156 KEKK-ATVCQDLESRyaehvAATQALPRDMGTASWKGRASLPETRKRQQlSEDALVIHGLPTESYRALYHSVVEPMLWNP 234
                         250       260       270
                  ....*....|....*....|....*....|....
gi 74739697   229 SGTPKRYSLELGKAIKQKLWEALCSQGAISEGAQ 262
gi 612015139  233 SGTPKRYSLELGKVIKRKLWEALCSQATAPSPEG 266
gi 612015137  240 SGTPKRYSLELGKVIKRKLWEALCSQATAPSPEG 273
gi 1040115737 260 SGTPKRYSLELGKTIKQKLWEALHGQGAGPEGAQ 293
gi 884939450  225 SGTPKRYNLELGKAIKQKLWEALRSQAATLKVAQ 258
gi 545544333  238 SGTPKRYSLELGKAIKQKLWEALHSQAATPEGAQ 271
gi 940758769  230 SGTPKRYSLELGKAIKQKLWEALCSQAATPEGAQ 263
gi 545869420  236 SGTPKRYSLELGKAIKQKLWEALCSQAASPQGPQ 269
gi 155372209  235 SGTPKRYSLELGKAIKQKLWGALCRQAAAPEDAQ 268
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap