Conserved Protein Domain Family
PELOTA_1

?
pfam15608: PELOTA_1 
PELOTA RNA binding domain
This RNA binding Pelota domain is at the C-terminus of a PRTase family. These PRTase+Pelota genes are found in the biosynthetic operon associated with the Ter stress-response operon and are predicted to be involved in the biosynthesis of a ribo-nucleoside involved in stress response.
Statistics
?
PSSM-Id: 317923
View PSSM: pfam15608
Aligned: 44 rows
Threshold Bit Score: 92.1697
Threshold Setting Gi: 0
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75541838   300 GIKEVNEIKNMYKISDINLIKPGVGETTRVLLRRVPWKILINNLDNPNLKHIKLLAKDKCIPIEVYKDM--SYSCCGVIK 377
gi 81550798   271 PVRAVLARAAELGVTDPHLVKPSVGEATRVFLRRQPAHLLLRDAAHPDTLHLRELAAASGTPVTMHPDL--PYLAAAIIA 348
4_pfamImport    3 AQRIIETLANHYQISNINRIKPTIAEATRAVMRRDPEQVLLASADHPDTALLRHLCQQKGVAVTVIGEQilPYQAVTIIK 82
27_pfamImport   3 SLDFLKAVAQQYRISHYNYIKPGIGEATRVLLRREAGRLLLGNPDSEATRHLLWLAESKSIPIEVCPDM--PYRAAALIK 80
1_pfamImport    3 TRFFLKEMMQQHHVSNKNRIKPGIAEATRVMLRRVPDLLIVQDKLSPSTVHLLKLAKEKNIDVVEMNDM--PFGACALIK 80
gi 123594643  292 TRIYLNRWIDSYGIGDINHIKPGIAEATRVMLRRVPERLLLRDPGAEEVAHLLILAEEKGVVVEHQPNM--PFNAVAFIK 369
2_pfamImport    3 SAEFLQSTTARHRITDVNLIKPGIGEATRVLLRRVPRLLILRDPSAPDVAHLKVLASEKSVPLMVDADL--PYQAVSLIQ 80
gi 81355868   281 SRVYMKEAMTQYGVTDENLIKPGIGEATRVLLRRFPQRVIVRDCHDRKVAHLVALAEEKAVPVETDASL--PYNAVSIIR 358
13_pfamImport   3 STALLADIRATFGIQNENFIKPGIGEATRVLLRRVPERVIIRDPEAPEVAHLLELAHEKNVRRQVDPTL--PYQAVSLIK 80
gi 123527127  282 STAFVEAMMQRTGITDRNRVKPGIGEATRALLRRMPERLFLRDPQDGDVGHLVALASSKGIAVETLADL--PYSACAIIK 359

                  .
gi 75541838   378 S 378
gi 81550798   349 S 349
4_pfamImport   83 K 83
27_pfamImport  81 E 81
1_pfamImport   81 D 81
gi 123594643  370 t 370
2_pfamImport   81 S 81
gi 81355868   359 S 359
13_pfamImport  81 G 81
gi 123527127  360 T 360
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap