Conserved Protein Domain Family
TerB_C

?
pfam15615: TerB_C 
TerB-C domain
TerB-C occurs C-terminal of TerB in TerB-N containing proteins. This domain displays multiple conserved acidic residues (TerBC). The presence of conserved acidic residues in both TerB-N and TerB-C suggests that they, like the TerB domain, might also chelate metals. These two domains may also occur together in the same protein independently of TerB.
Statistics
?
PSSM-Id: 317928
View PSSM: pfam15615
Aligned: 26 rows
Threshold Bit Score: 97.05
Threshold Setting Gi: 501423307
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122374932 676 ATSGKESPAASKAAFSLDSSR-IEALQKETAKVSALLAgvfAED--------------------EPIAETADDVAEQPTA 734
gi 122397103 475 ADYQEILIERARPKVKINLAS-LDQIRSDAAETKESLL---TEEerqle----------aeeaeRITSESNKQVSESSAT 540
gi 500068341 501 LKNVSKVYEVKRKKIQLDTTL-IKKVQQQHSGTVELLNeylKDDfenennsi-----ksqeinnEEIKIEITQKSEATSH 574
gi 502955673 246 LTDLYTKKQAQQSEISQLHNQ-ISLLQDERHLLQNQVWellQNMetldqda------ltentqeDLELFPFDEILEPVDP 318
gi 502702886 353 EEERKEQAEAEKRKVVFHLDQ-LDRIRQDAAVTRDKLM---TEEerr--------------eevLPAIPEQPDPSATWER 414
gi 493333282 429 EAVLEERRRAQARRITIDFSR-LDAIRQDSALTRDKLI---VDEeedie----------eeedaEDRQHELLTPDEVETF 494
gi 503473796 374 ETWLGWKRDHAPRVIDIDLSK-LARIRKAAEGVCEALL---VDEerapgpsegldpdettatkdAPSDPLLSRVPAAPQD 449
gi 503264136 368 TILQDEKRQAEKLRVDIDLSK-LGSIRRAADITRDKLI---VDEedled-----------diipQPDMQEDVPEENVQKN 432
gi 501423307 491 NREKIQLDENEAKEIKLNHESfINQFQENVEDEVDAIEestEDKe-------------------gKNKKDIFEEPEIFEE 551
gi 506258370 305 IDEILKLDKKPQKKIQIDKSK-LADSRKDLDETVSIVEdflSDSdalsfe---------evpreDIITEDDRKVNQESKE 374
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122374932 735 RGLL----------------------------------GLDDAHSTFLRLLLSRpsw-trsELADAASDLDLM-LDGAIE 778
gi 122397103 541 EEKMtkdide----------------------taasglGLDENEEQLLLALFSGq------PYQDFLLQRHLL-LSVVVD 591
gi 500068341 575 SAFVsd-------------------------------lTFSPIHISTLELFSKSnfsilqsELEIFAKSKGIF-KNQLIE 622
gi 502955673 319 SSPTsdnlppe---------------------wsnfleKLPTNQIHVLKAIVAQdnp--kaIIKQIAEEHMTM-PNLLID 374
gi 502702886 415 GNRLagspdgsdwedtsarasspagenppapessglpwNLTEDEYHYLKDLLYg-------RDTSWTGTKGLM-PSILTD 486
gi 493333282 495 EEAVdsggg-------------------------kdewGLTEEEDRYLRCLLAG-------EDLSWLSQEGLM-ESILVD 541
gi 503473796 450 GGARisrapa----------------------qaagsgPLSAEEADWLRALLDRd-----eRARSVAQAAARIsQDMLID 502
gi 503264136 433 TT------------------------------------PLDSGEYSFMQVLLYGg------DHQAAARSVGSM-PSVMAD 469
gi 501423307 552 DLDLkkf-----------------------------isELTENERLLLKRLFEDgql-iieEVNNFLRDIGVT-TGVFIS 600
gi 506258370 375 NESI----------------------------------SISETSKTFLKLILDKgsl-gedDASQIALEEGKI-LNSFIG 418
                        170       180       190
                 ....*....|....*....|....*....|...
gi 122374932 779 QVNEASLDHWDEPLTD-GDDPVEINQEFAQRLA 810
gi 122397103 592 QINEKIFDEIGDAVIDcDGQKAEIVEDYRSDLa 624
gi 500068341 623 SINETCYDFLDDVLIEeEDDYYTINTNYFQRIF 655
gi 502955673 375 AINEVANLTLGELVIKtDAEIPEIYQDHILNLR 407
gi 502702886 487 SINEKCYEEFGDTVLE-AGDPPSVIEDYLEDLK 518
gi 493333282 542 SINDHLFEFFSDTVIE-PDPQARIVDDYRRDLa 573
gi 503473796 503 AINEKMLEILGDTVIEcVDGSPRAIDDYESDLK 535
gi 503264136 470 SINEKLYDIFADTVIEfDGDTPVIIEDYEEELK 502
gi 501423307 601 KLNEKSDEILGDVILEqRGEHFIINEDFEELVE 633
gi 506258370 419 DINEELFDYIDDQTLInEDGKISIDSFYVEMIK 451
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap