Conserved Protein Domain Family
C-C_Bond_Lyase

?
pfam15617: C-C_Bond_Lyase 
C-C_Bond_Lyase of the TIM-Barrel fold
This family of TIM-Barrel fold C-C bond lyase is related to citrate-lyase. These genes are found in the biosynthetic operon, with other enzymatic domains, associated with the Ter stress response operon and are predicted to be involved in the biosynthesis of a ribo-nucleoside involved in stress response.
Statistics
?
PSSM-Id: 317930
View PSSM: pfam15617
Aligned: 68 rows
Threshold Bit Score: 315.26
Threshold Setting Gi: 503322646
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75541836    30 TYMQYALGATLYMPGVRDDIFEIIYKNKYNSMQSMVICLEDAISEKDVEKAETNVIDICKKITYCI---ETkkiNP---N 103
gi 81568767    30 EQLAYALGATLYTPGTKETIAEDIIRKKHVEATSIIFCLEDSISDKEVKFAEQNIVFQIQQISNLV---SDnilNQ---A 103
gi 81667114    30 RILEYALGAALYVPGNRKDIADVIINNKYPELCSVVFCLEDSIGDCEVLQAENNLVSQADMIYQAQ---KLqniNS---D 103
gi 447028817   30 EQLAYALGATLYTPGTKETIAEDIIRKKHVEATSIIFCLEDSISDKEVKFAEQNIVFQIQQIANLV---SAnilnQ---A 103
gi 447028818   30 EQLAYALGATLYTPGTKETIAEDIIRKKHVEATSIIFCLEDSISDKEVKFAEQNIVFQIQQISNLV---SDnilnQ---A 103
gi 1032346755  30 EVLAHALGATLYMPAIRTTISHDVMTQKHEGLVSMVICLEDAIGDHEVSEAEQSLIRQVRDISSRL---RNgliqQ---D 103
gi 1027703370  30 kLLEQALGAVLYMPATRHDIAAVITNQKYEDLSSVVFCLEDAIGDDEVKQAEHNLKHQLERIDQAV---QQr---KqlaE 103
gi 503134961   10 sILAYAIGAALYMPATRLEVAEEIKNGKHEGLTTVILDLEDAIGDQQVGQAEESLAQQLFQLLSYV---RTgmmsE---Q 83
gi 500857331   30 HVLAHALGSTLYMPATREDIADMLLSQKYEALCSVVFCLEDAIGDQEVDMAEQNLVAQLTSLKEKVthaPEt---A---E 103
gi 501249098   26 DILSYALGATLYMPASMPNIVGLIQSQKYKELTSLVIDLEDAVGDSELGDCEAKLLEDISELYKLY---HQkqlLL---Q 99
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75541836   104 NLPLIFLRVRSVEQFKKILNK-KGFFIPITGFVFPKFDSTNGEEYLNILDKFNDKRtn---------iLYGMPILESKRV 173
gi 81568767   104 DIPLLFIRVRQPSQMRTIVTElGSAVHCLCGFVFPKFTPVNGKSYIDQLAYINKLYsl---------sLYGMPILESPEI 174
gi 81667114   104 VLPLMFIRVREPEQMLELGNKlGRALHLFAGFVFPKFSMLNAEHYLDTLTKLSQESgi---------vLYGMPIFETPDL 174
gi 447028817  104 DIPLLFIRVRQPSQMRTIVTElGSAVHCLCGFVFPKFTPVNGKSYIDQLAYINKLYsl---------sLYGMPILESPEI 174
gi 447028818  104 DIPLLFIRVRQPSQMRTIVTElGSAVHCLCGFVFPKFTPVNGKSYIDQLAYINKLYsl---------sLYGMPILESPEI 174
gi 1032346755 104 DIPIMFVRVRDVHQMNRLVEElQEDLISLTGFVFPKFTSRNAEEYLEALQSCNRYVpf---------pVYGMPILESADI 174
gi 1027703370 104 HFPFMFVRVRSPQQLKTLADMlPHSLHLLTGFVFPKCSIENANHYFEALQEVSQQYgt---------vLYGMPILETPDV 174
gi 503134961   84 QLPLLFVRVRSVEQLERLLNSlGEALELLTGFVLPKFSSDNGRAYFALIAEYNRTMhtgagdasrtpvLYGLPILESSKI 163
gi 500857331  104 HLPLIFIRVRSPKQLLKMADLlGSSLQLLTGFVFPKCSVHNAKEYLDSLKQASAQTqt---------iLYGMPILETPDL 174
gi 501249098  100 DIPLLFIRVRHVEQFNYLTSSlKEKQEVLTGYVFPKFTATQGAQYFELLEKTILENnl---------tLYGMPILESREV 170
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75541836   174 IYKESRIDELLKIKSILDKYKKYILNVRIGATDYQGLYSLRRGIDNSIYDIGVVSDCIYDIINIFSRADNEYVISGPVWE 253
gi 81568767   175 MYRETRVKSLLQIKDLLDSYRDYILNVRIGATDFSSIFGIRRNKHTPIYHITVVRDCISDIINIFSRATNGYVISGCVWE 254
gi 81667114   175 LAMETRAKALQELKSTLGFYQDIILNIRIGATDLCGLYGLRRKPETPIYDILVISDFIKDIVNYFGL---QFVISGPVWE 251
gi 447028817  175 MYRETRVKSLLQIKDLLDSYRDYILNVRIGATDFSSIFGIRRNKHTPIYHITVVRDCISDIINIFSRATNGYVISGCVWE 254
gi 447028818  175 MYRETRVKSLLQIKDLLDSYRDYILNVRIGATDFSSIFGIRRNKHTPIYHITVVRDCISDIINIFSRATNGYVISGCVWE 254
gi 1032346755 175 IYRESRTAELLSIKKILDKYRHLVLNVRMGATDFSSLFGLRRGPDVSIYEISTIRDCIGDIVNMFTRQGSEYVVSGPVWE 254
gi 1027703370 175 LSKKTRMDVLSELHMIFQQNKDVILNVRIGATDLCGLYGIRRKPDQSIYDIRLIADFMADIINYFGA---DFTISGPVWE 251
gi 503134961  164 IYRETRWKELLAIKEILDEVQEYVLNVRIGATDFSSLYGLRRSPDITIYEIAVIRDCIADIINLFGRVDSDYVISGPVWE 243
gi 500857331  175 LEKETRYTVLSELKQILLNDEEYILNIRIGATDLCGLYGIRRDRDTTIYEIHLIADLITDIINYFGRS---FVISGAVWE 251
gi 501249098  171 LYKESRMEALLAIKSVLQQYQSRVLNIRIGATDFCGIYGIRRRMDSTIYDISLIRDCIADIVNVLGREEDGFVISGPVWE 250
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75541836   254 YFN----------SN------------------------DqnRvlkpmlr------------------ktpfvenEgqeg 281
gi 81568767   255 YFS----------N-------------------------Dye-------------------------------------- 261
gi 81667114   252 YFG----------D-------------------------Asrtvp-------------------------pfapnWaeag 271
gi 447028817  255 YFS----------ND------------------------Y--E--------------------------------E---- 262
gi 447028818  255 YFS----------ND------------------------Y--E--------------------------------E---- 262
gi 1032346755 255 YFS----------NG------------------------E--RllkpqlrqspfeqklggasgrrlrqqllnqwqD---- 294
gi 1027703370 252 YFDpslkaaphpfHQ------------------------A--S--------------------------------Dfse- 272
gi 503134961  244 YFS----------HR------------------------E--Rifkpqlrvspfedafg-kpgrylrmdfisdavD---- 282
gi 500857331  252 HFG----------PVrkeqkpfiralshksgessssefdD--V--------------------------------Q---- 283
gi 501249098  251 YFS----------N-------------------------Q--Rvlkpalr------------------mtpfsekGalet 275
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75541836   282 iikrkhylekyvdGLIREVILDKANGLVGKTVIHPTHIKLVNALYTVTQEEYEDALEILQiNDKG--GVNKSKYNNKMNE 359
gi 81568767   262 ------------eGLIQEVSLDHANGLIGKTVIHPSHIKVVQAMHIVTMEDYLDARSILQ-HANTynGVLKSSFANKMNE 328
gi 81667114   272 essl--vinrymdGLINETLLDLANGIHGKSVIHPSQIKAVQSLHVISMEDYLDALSIVE-SADGtrGVVKSSFSNKMIE 348
gi 447028817  263 -------------GLIQEVSLDHANGLIGKTVIHPSHIKVVQAMHIVTMEDYLDARSILQ-HANTynGVLKSSFANKMNE 328
gi 447028818  263 -------------GLIQEVSLDHANGLIGKTVIHPSHIKVVQAMHIVTMEDYLDARSILQ-HANTynGVLKSSFANKMNE 328
gi 1032346755 295 -------------GLIKEVLLDKENGLTGKTIIHPSHIKIVHSLAVITREEYEDARAILQ-SQTN--GVTKSHYANKMNE 358
gi 1027703370 273 ----------ymeGLVKETTLDIANGIHGKTVIHPTQLKVVNSLYVVSKEDYTDALHIAH-HAKGtlGVLKSNFSNKMNE 341
gi 503134961  283 -------------GLIREVMMDKENGIIGKTIIHPSHIKPVQAMYAVTHEEYMDALEIVE-RNDGslGVFKSTYANKMNE 348
gi 500857331  284 -------------GLLKETKLDVANGIHGKTVIHPTHLKPVQSMYVVTKEEYMDALSILE-HADGtiGVMKSTFSNKMNE 349
gi 501249098  276 rka---llddcldGLIKEVLMDKQNGIVGKTVIHPSHIRVVHALYAISYEEYLDALSIVE-HNDGskGVMKSHYANKMNE 351
                         410       420
                  ....*....|....*....|
gi 75541836   360 SKPHFNWANKIMKRAYVYGV 379
gi 81568767   329 VKPHYNWARKTILKSNIYGV 348
gi 81667114   349 IKPYLSWAKKILLKAEIYGV 368
gi 447028817  329 VKPHYNWARKTILKSNIYGV 348
gi 447028818  329 VKPHYNWARKTILKSNIYGV 348
gi 1032346755 359 IKPHTSWAKKIMIKSKVYGV 378
gi 1027703370 342 MKPHMKWAETILLKSDIYGV 361
gi 503134961  349 IKPHLNWAYRIINRSKVYGV 368
gi 500857331  350 TKPHYRWAEHILMKSDIYGV 369
gi 501249098  352 IKPHMRWAQRILKQAHVYGV 371
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap