Conserved Protein Domain Family
CENP-C_mid

?
pfam15620: CENP-C_mid 
Centromere assembly component CENP-C middle DNMT3B-binding region
CENP-C is a component of the centromere assembly complex in eukaryotes. CENP-C recruits the DNA methyltransferases DNMT3B, in order to establish the necessary epigenetic DNA-methylation essential for maintenance of chromatin structure and genomic stability. This middle region of CENP-C is the binding-domain for DNMT3B. Binding of CENP-C and DNMT3B to DNA occurs at both centromeric and peri-centromeric satellite repeats. CENP-C and DNMT3B regulate the histone code in these regions.
Statistics
?
PSSM-Id: 317932
View PSSM: pfam15620
Aligned: 20 rows
Threshold Bit Score: 223.875
Threshold Setting Gi: 0
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940345  266 KLLEDEFIIDRSDRSFSSRLWVMIPSK-DRHLSAHKPSP-ENTALLQGKKSREKSHSLSAMTFARNTQSD---------- 333
11_pfamImport   1 KLLEDEFIIDESDISFGNQSLIKIPRN-VKPPKQRTISPvESTVVLQGKKSREKHHNV---TLTSDKNSH---------- 66
15_pfamImport   2 KLIEDEFVIDESDRSFAIQSWITIPRK-AGPVKQGTVSPaETTALLQGKESREKHSHVSPKTLASDKASC---------- 70
17_pfamImport   2 KLLEDEFIIDGSERSFASRSWITIPRK-AGHLNQRPVSPaENPAPLQAKKSREKHHSVLPETLTNGIHSH---------- 70
12_pfamImport   2 ELSNDEFIIDESDCS-VSQDWILIPNKnSKSVKQRKADPvESFQDPERKKARIEQQQGGNCNTASDKHSDtengisdftv 80
9_pfamImport    2 KLVEDEFIIDESDQSFASRSWITIPRK-AGPLKQRTISPaESTALLQGRKSREKHHNLLPKTLANDKHSH---------- 70
10_pfamImport   1 KLLEDEFIIDESNRSFASHSWISIPRK-VGPLKQRSVPPtESTAVPQVKKSKERHHSISPTTSTHDNHLD---------- 69
1_pfamImport    2 KLLEDEFIIDGPDRSFSSQPWVVIPRK-GHHM----PFP-ENIAVPQGKKSREKPHRLSEKTLVSNTQTD---------- 65
16_pfamImport   2 KLLEDEFVIDESDKSFASGSWITIPRK-GGSLKQPTISPdESTAVLQGKKSREKHRSVSPNTLRSDQHLH---------- 70
14_pfamImport   2 KLLEDEFIIDKSDRSFTNQSWITIPRK-GRSWNQHTVSStGSAAILQGKKARE-HQSVSPVTLTGDKYLH---------- 69
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940345  334 ----------KAHPIEEAQLSVEENPATTC--TDELENDCRSPENKMQSETAKTPPAWERTTKQSQRRVSKPKAAEE-LR 400
11_pfamImport  67 ----------KAHPVEKPQPFEGKKLGKSCasASEMENNCKSTKDALYSENAEKPSENKGTIKQNRRRKVKAKVVEEhLD 136
15_pfamImport  71 ----------KAQPLEKSQPSGQERLGTSC-----MENDSRSTKREIHSQD-KKSSGSKKAIEQKQTRKLKVNVVEEqLH 134
17_pfamImport  71 ----------GAHPVEKSQPSDQENLCTNCalTDEMENSCRSTKYKMCSENAEKSPGNKRTVKQKQRTKSKDSIDKDqLD 140
12_pfamImport  81 gkktsksikkKl--------------------SPEMGNASKSTRHTLYSEETEQFFEKKKTVMQHQSENCMDQNGVYkHK 140
9_pfamImport   71 ----------KPHPVETSQPSDKTVLDTSYalTGETENNYRSTKYEMYSKNAEKPSRSKRTIKQKQRRKFMAKPAEEqLD 140
10_pfamImport  70 ----------GSHPVEKSLPCDDKKQSMSCalTDEVDNNSRSTKCETHSKNKGKSSGNKKTVKQKKKKKYKANVVEEqLH 139
1_pfamImport   66 ----------KTGPVEEAQLSVEEKLGTTL--TNEVENDCRSTENKTHSENAKKPSARKRTVKQKQRRPSKPNVAQE-LS 132
16_pfamImport  71 ----------KAHPEQKFQPCDEKKVDTSSslTDELENNDRSTKYEISSENVKKPSENKRPIKQNQRRKFKANVVKEqLD 140
14_pfamImport  70 ----------KTHPEEKSEPSCEQKRSINCtvIDKLENSHRSIK--MYSE------------------KFKTNVVEEqLD 119
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940345  401 KGQSSWENSNV--SNTGQDKLQINSKRNMKDCEEVRNEPNPKKQKPAL-ENKKKTNST------QTNKEkSGKKFFSGGS 471
11_pfamImport 137 MEQPKDKNINT--SFTVQGKLQRNSDKNTEVCEEMRNDHISPKQIFFIlGKKKSRTHVpikenqKKVKEkLKNKRFSNQP 214
15_pfamImport 135 MEQSDDENLNT--SHIAQNKFQRNSLKSMEECEKMRNDHVSKKQMPPV-ESKKSSS--------RKHEEeSKKKRFSTES 203
17_pfamImport 141 VGQSKDGN--M--SHIAQKKLQRNSDRNTEECEEKRNNRISKKQMPSM-GSKNST---------KKDKEeSKKKRFSSGS 206
12_pfamImport 141 VGGKHQKRFNV--SQTNQDKLQSASDRSLGQEEERAESCHSTKRKPSA-AASQQIQKKglnkirSKNQQmSMKREITLKP 217
9_pfamImport  141 VGQSKDENIHT--SHITQDEFQRNSDRNMEEREEMGNDCVSKKQMPPV-GSKKSST--------RKDKEgSKKKRFSSES 209
10_pfamImport 140 MGQSKEENINAhkKHIAP-KLQRSSSRNMKDCEEMRNDHIS-KMVPSV-GSKQKKSTK------KQDKQeSIKKHSPSES 210
1_pfamImport  133 MGQNETENRNM--SKIGQDKLQINSKRNMEDHEEVRNEPTPKKPVPAL-GNKKEKDST------QANKEkSRKKCFSRES 203
16_pfamImport 141 LEQSKDKNVNM--SHSAEDKLQKNLHRNGEDCEGTRNDNIFKTPTLPV-GDKKINRGT------KNNKEeSRKKHFSSES 211
14_pfamImport 120 TGQSEEEN--I--SDITQDKIPRNSERTIEDCEKMRNDHSATKGMPPV-ENMKTKCRT------KKDRKeSRKKHFSSES 188
                         250       260       270       280       290
                  ....*....|....*....|....*....|....*....|....*....|
gi 341940345  472 -KNKFVPKKVTLTSRRSCRISQRPSEWWRVKSDESSVDRN-PSKENNSPV 519
11_pfamImport 215 kKESLVPEEVTLTVTKSRRISKPPSNWWEVKSDQSPVGSNsSLIKNELS- 263
15_pfamImport 204 -KNKVIPEEVTLTVTRSRRISRCPSNWWVVKSEQRPANSN-SSIRNELS- 250
17_pfamImport 207 -KNKVEPEGVTLTVTRSRRISRCPSDWWVVKSEQSNYYNI-RNLLNEESV 254
12_pfamImport 218 nQSQ------KFTITRSQRISKRPSNWWVVTTEESKYISN-KLTMRESPV 260
9_pfamImport  210 -KNKLVPEEVTSTVTRSRRISRRPSDWWVVKSEESPVYSN-SSIRNELPV 257
10_pfamImport 211 -KNNLVPEKVT--VLRSRRISRRPSDWWVVKSQESPAYSDySSIRNELSV 257
1_pfamImport  204 -KRKSVPKEVTLASRRGRRTSQHPSEWWLVKPSEGSVDGN-SSKENESSI 251
16_pfamImport 212 kKNKLVPEEVTITVMRSHRLSRRPSDWWVVKSDESPVHSN-SSIKNELSV 260
14_pfamImport 189 kRKKLEPEETTSFVTRSHRVSRRPSDWWVVHSKESPVHSN--SPRNDVS- 235
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap