Conserved Protein Domain Family
Tox-MPTase5

?
pfam15641: Tox-MPTase5 
Metallopeptidase toxin 5
A zincin-like metallopeptidase domain found in bacterial polymorphic toxin systems.
Statistics
?
PSSM-Id: 317948
View PSSM: pfam15641
Aligned: 2 rows
Threshold Bit Score: 225.372
Threshold Setting Gi: 0
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 502766775 2025 ELSKATGKTTASRNRAIDAIISEDFPDLNLTHRPVYSYGVNSGMAKPNVGTHIGFKRFASRALLRNTVVHEELHHRWFAR 2104
1_pfamImport    1 ELSKATGKTTASRNRAIDAIISEDFPDLNLTHRPVYSYGVNSGMAKPNVGTHIGFKRFASRALLRNTVVHEELHHRWFAR 80
                          90       100       110
                  ....*....|....*....|....*....|
gi 502766775 2105 GLRNHHPRDGSGTSERFYGIIDRYMSIRGW 2134
1_pfamImport   81 GLRNHHPRDGSGTSERFYGIIDRYMSIRGW 110
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap