Conserved Protein Domain Family
CF222

?
pfam15661: CF222 
C6orf222, uncharacterized family
This family of proteins is found in eukaryotes. Proteins in this family are typically between 618 and 652 amino acids in length.
Statistics
?
PSSM-Id: 317964
View PSSM: pfam15661
Aligned: 11 rows
Threshold Bit Score: 811.797
Threshold Setting Gi: 1040167312
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81899812    31 KRARSLDRQVPRKKDPessntRCPS----SATCR----RTASDGARSSES----PSHFAEAQGATAAALPPGEGRGFLPS 98
gi 961729699   10 RRARSLDTSQSPKKVR-----RCFSl--pTTPSRrmlhQAASDGSRCPQS----PAQSVEAQDATATAHSLEETREFLPT 78
gi 884925877    8 RRARSLDRPRVLRKDSetsscQCLSl--pSTPCRwapcRAIGEGARGSQSldspPSGAQDAEG--AAVHTPEETRGFLPS 83
gi 532066185   14 RRAQSLDRPQAPRKDSgsgncQCLSf--sTAPCRrplrRTSSDGARHSGI----PAQSAEAQGTVTTALTLEGMRGLLPS 87
gi 1040167312  14 RRTRSLDRPKAPPRGCts---gnLSl--aASP-RralrRTASDGARGPES----PALSVG-----SAALPPEDM-----G 73
gi 1034175020  14 KKARSLDRPQAPGKGSeswdcHCLSl--pTAPSRkalhWTTSDWARHSDS----PAPSAEAHCTTAAAPTPEETGEFLPS 87
gi 395832617   14 RRTKSLDRLQAPRKDSesrdgQCLSv--aTASSRktprRTASDGAR----------RSTEAQGPVAAALTLEETREFLSN 81
gi 940763761   27 RRARSWDRSQKPRKDLesregQYLSl--pATPPRpapaGRAHDGSRHLSG----PGS--------QEALSLEAARELLTS 92
gi 345778412   14 RRARSLERSHSPKKDSeswncKGHSlpmsTPPSKrvlhQTASDGTRCPQS----PAHG-------HGALSLEETKKFLSS 82
gi 927156494   14 RRARSLDRSQDPRRDSepgdcQCLSm--pATRSRrmlrRTASDGTRCAKS----LAQSSEAQGPTATALSSEETREFLPS 87
gi 296474536   14 RRAKSLDRLQNAKKDSeswdcQGPSl--pTGPFRgglcRTASDGARCLKS----PVQSVEAQDTTAAAPSPEETKDLL-S 86
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81899812    99 EQGPPEDTKKERL-PREAQQSWLRLVLNILLMR-I----------------------EEPREKASRASKGK------GDL 148
gi 961729699   79 DQRLPQDTKKEKT-QRRGQQGWLKTLMNFLLRTgP----------------------EEPKEKASRKAKGKegfpkpAET 135
gi 884925877   84 EQRPPPDIKKDKA-QWRAQQGWLKMVLNFLWRTgF----------------------EEPRDKASRRPKEKee---pPES 137
gi 532066185   88 EQRPQQDAKKHKA-QRRAQQGWLKAVLNFFLRTgP----------------------EEPREKASKRPKGKee---pSEP 141
gi 1040167312  74 EQRPPQDAKRDKApRWWAQPRWLKTLLSFLLRAs-----------------------EEPKEKASRRPRGKegfpqaSEP 130
gi 1034175020  88 EQRPLQDTKK----------GWLKTMLNFFVRTgP----------------------EEPREKASRRPRGKegisqhPEP 135
gi 395832617   82 EQSPPQDTKD------KAQQGWLKKMLNFFLRTgP----------------------EEPREKASRQTKGKeg---pVHL 130
gi 940763761   93 EQRPPRDKKD------------------------KaqsrsqqgllktvlnfflrtspEEAKDKAARRARAKeglpppAET 148
gi 345778412   83 DQRPPQDTKKDKT-QKRGQQGWLKTIINFFLRTgP----------------------EEPKDKASRKAKGKeglpksAET 139
gi 927156494   88 EPRPPQDTKKDKA-QWRTQQGWLRTMMNFFFGTgH----------------------EESKEKASKRAKGKegppepAET 144
gi 296474536   87 EQRPLQDAKKDKA-QWQAPQGWLRFVVNLFFRTgP----------------------EEPKEKTNKKAKGKegpsepTET 143
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81899812   149 PEAAEEPALRKKS-HEKRTSRKKHSHRKPIAEEPPGPQTAEAQGREDVPPSLAASSAPHEIALGLICRG------G--PD 219
gi 961729699  136 PEAPGETAPRKKA-HDKKASRKKHSHKKHVADETKGAQDQEAEGQEIGLPKMAAAPRPEEADLGPAPKGeqtmpgG--KG 212
gi 884925877  138 PETAEELGLRKKA-PDRKASRKKHGHKKHGAAEAAGNQDREARPPQDRLPTSQA----EDPEAALVCRG------G--RD 204
gi 532066185  142 PDGPGEPALRTRA-RDKKASRKRHSHRKH-----------DAEDPEAGLPRTEAAS-TEEADPGPAGRG------GhgHD 202
gi 1040167312 131 PEAAGEPACRKKV-QDTKASRRKSGSKKPSPEETNGTQDMEAGDQQAGRPRLSPAHGG-----------------G--ED 190
gi 1034175020 136 LEAAGEPALRKKAhHDKKPSRKKQGHKKHAAEVTKAAQDQEARGQEEGLSKAAAALRSGEADLGPARRG------G--ED 207
gi 395832617  131 TESPREPDLKKKA-HDKKASRKKHGHKKHVAEEPKGAHDEDARGPEAGLSKTAAALHSEEVDLGPARGG------R--ED 201
gi 940763761  149 SE------PRKKA-HDKKAGRKKHGHRKHGDGDARGAPGQEAGGRD-----TAAAWRSQEADPGPGPRG------G--AD 208
gi 345778412  140 PEAPGDTAPRKKA-HDKKASRKKHSHKKHAAEETKGAQDHEAEGQETGLPNLAATPCSKEADRGPAPKGeqtvpgG--EG 216
gi 927156494  145 PETLGEPAPRKKA-HHKKASRKKHSHKKHSAEEVKGAEGQEA--------KAAAASCCGEADLGPGAGE------G--DI 207
gi 296474536  144 PESLGEPAPRKKA-HSKKASRKKHSQRKRCAEEARGARDQEAEGQEA---KAAEASLSEGADLGPAARG------G---- 209
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81899812   220 SDLPQALPTEGDHAETPDSFGQASGPPLEEDPRKPD-QDDVIWQIVELLKKAGDQLEEE-QV-----------QIPQPEA 286
gi 961729699  213 SGLHQSLLIEAGGPAASEVSSQATGHRPEEELRQLD-QDKIIKMIVEFLQKVGDQWEEE-QL-----------QAPQPEV 279
gi 884925877  205 SGDHLSLPSRGASAGQLDSSPQATGSGPEEEPGRPD-QDDVIRMIVEFLKKVGDQWEEE-QS-----------QASQPAV 271
gi 532066185  203 SFLHPSLPIEVGGAGFSGVSPQAAGAQPEEHLRKPD-QDAVIQRIVELLKKVGDQWEEE-QL-----------QVPRLEV 269
gi 1040167312 191 DQLHQSLLTEGEGAGAADVCPQATDHRQEEALTKPD-QEAVIQMIVRLLRRVGDQLEEEa-------------------- 249
gi 1034175020 208 SD-HQSFLIEVDGTGALDVSPHATGHQQEEELKKPD-QDAIIQMIVELLKRVGDQWEEE-QS-----------LASQLGV 273
gi 395832617  202 SDLHQSLVVEESGAAALNVSPQASDHQREE-IKKPD-KDAIIKMIVELLKKVGDQWEEE-QL-----------RAPQPVV 267
gi 940763761  209 PDPHQSALIEGRGAGASEPSSQATGPRPEEEPQKLD-QDTIIQMIVQLLQAVGDEWDEEvRNlaqffpgplqlQGSQREV 287
gi 345778412  217 SDLPQSLCIEDGVPGAAEISPQATGHRWGEDLKNTD-KDTIIKMIVEFLQRVGDQWEEE-QL-----------QAPQLVL 283
gi 927156494  208 SDLHCFLLFEGRSAGVQGISSQATGHQREEELRKPD-KDTIIQKIVELLQKVGDQWEEE-QR-----------QASQPEV 274
gi 296474536  210 ------------GARVWKVSFQAVGHQQEDKLRKLDiTDIIIQKIVELLQKVGDQWEDE-QH-----------QALQSVV 265
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81899812   287 VPPrKPTP---LPRKKSQEKK-SSLKRVLS--LKKP--ASEEPKRVGTATTLGPETR-PKRPSFLPL----CV--SSQRA 351
gi 961729699  280 VVQ-IPVS---FDRKKFQEKK-SSFKRAFS--HKKH--GSEEAKRAGPADVSSPESRpPKRPSFLPL----CV--GGHQP 344
gi 884925877  272 LLQ-NPAL---GCTRKSQEKKpSSHKRAFS--LKKY--SSEEPRRVATADVPSPRGRpPKRPSFLPL----CMggGGPRP 339
gi 532066185  270 ALQ-NPSP---VCKRKSQERK-ASLKRAFS--LKKYgpGPEESRRAGAADVPSAEARpPKKSSFLPM----CV--GSHRS 336
gi 1040167312 250 -------------RALRKQK--SSLKSAFS--PRKP--SSEAPRAAGPADGSSSDARpPKRPSFLPL----CV--GGHRP 304
gi 1034175020 274 ALP-NPAP---AVRKKSQEKK-TSLKRTSKtnPKKH--GSEEAKR-GAADVSSPEARpPKKSSFLPL----CV--GGHRP 339
gi 395832617  268 AMQ-NPVP---ASRKKSQEKK-SSPKRDFS---KKH--SSEEPKRAGATDVSTLEARpPKRPSFLPLhlpqCV--GGHRP 335
gi 940763761  288 APQ-NPAPapaVVRKKSQERK-PSLRRTSS--HKKQ--GSEEPRRAGAADAPSPESRpSKRPSFLYM----CV--GGHRA 355
gi 345778412  284 VSQ-NPAP---AVRKKSQEKK-SNFKRAFS--HKKH--SSEEPKRAGPGEVSSPESRpLKRPSFLPL----CV--GGHQP 348
gi 927156494  275 APH-PPAP---VAGRKSQERK-SSVTRAFS--HKKH--SREEPKRTVAAEVSSPESRpPKRPSFLPL----CV--GSHRA 339
gi 296474536  266 TPR-NPAP---VVKKKSQEKM-SSLKRAFS--FKKY--VSEEPKRAGAAHVSSAESRqPKRPNFLPL----CV--GGHRP 330
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81899812   352 STSSSLDLEAPEFQEVPSVDGGGSHPSELHTPAAIfQGPEEKPLLDRASESREFRRKILVLLQSAEDERGE------QEA 425
gi 961729699  345 STSSSPGSEEPKVQEVLPTDSGGLSPLELSTPAGS-QGPEEDLQANRALEFREFIQKIIALLQDAEGQGGEflssppQQL 423
gi 884925877  340 STSSSPGCEGPGAPEAPSADSDSPSPPELPTRAAC-QRPEDELPLDGTSESSEFMRMILGLLQDAEEQAGE------QQP 412
gi 532066185  337 SISSSPGLEGPEVHEALSADGEGPSPSEPPTHARC-QGPVEELPLDGASESNKFFQKILALLQDAEEQEGE------QQP 409
gi 1040167312 305 SVSGSPGLQEPEAQPA---GGGSPSPSALPTPAGL-QGSEAALQLDRASESKEFIRKITALLQDVEGQ-GA------ERF 373
gi 1034175020 340 SISSSYGLEEPEVQEAPSTEAGAPGPSVLPTPSES-QEPGEELPLDRASEYKEFIQKIISMLQDAEEQQGE------EQP 412
gi 395832617  336 SISSSLGLEEPEVQGVLSTDSGSSSPFKPSTQPES-QRPGEELQPDRASESKEFIQKIVALLHDAEEQGRE------KQT 408
gi 940763761  356 SISSSVDLEEPEVQEASSTDCGGPSPFELSIHSGS-PEPGEDLQPDKASECKEFIQKIVALLQDAEEQEGE------KQL 428
gi 345778412  349 STSSSPGLEEHNIQEAASTDSGGPSPFQLSSQAGG-QEPEEDVQTNTALEFKEFIQEIIALLPDAEEQWGV------KQL 421
gi 927156494  340 SNSSSLGMEAPEVPVAPSTADGDPSPLELSTPAGS-RGPEEDLQLDRASEFKEFIQKIIALLQDAEEQVAD------KQ- 411
gi 296474536  331 SSSSLPGVEEPEVQEAVTTDGGDPSPFELCTPAES-GGPDKDLQQDRATEFKEFIQKIIALLQDAEEQCRD------KQL 403
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81899812   426 QAQEAEKAGENPTPAGKVKSQVKK-SNLRRAFSLRKHSSKDSKKTEASgtpGSGSLEARPPKKHGFLPMCVSGHRASISS 504
gi 961729699  424 RVQEPEVAVENLSPPYRRRSQEKK-SSLRKAFSYKRHGPKEPRRAGAT---SAASLESRPPKRPSFLPLCVGGHQPSTSN 499
gi 884925877  413 QVQEADAAGEGLALAGRWKAQEKKpSGLRRAFSHKRHSFKEPRRAGAArtgGAATPESRPPKRPSFLPLCVGGQRTSISC 492
gi 532066185  410 QVQEVEVAVENPAPVCRKKSQEKK-SSLRRAFSHKKHSSKEPRRAGTV-------PEAGTPKRPSYLPLCVGGHRSSISS 481
gi 1040167312 374 QVQE--------APPCRSTSHEKK-STRKKAFAQKRHGSKEPKRAGAA---AASSPDPRPPKRPGFLPLCVGGHRPSVSG 441
gi 1034175020 413 QVQQEEVGVENPAPHCRRKSQEKK-SSFRRAFYHKKHTSKEPRRTGAA---GAASPEARRPKRPSFLPLCVGGHRPSTSS 488
gi 395832617  409 HIQEVEATVESLAPPCRRKSQEKK-SSFRRGFSSKKHSSKEHQKAGSSgatGAASPEARRPKRPSYLPMCVGGHRPSTSS 487
gi 940763761  429 QVQEPEVASENPAPPYRKKSQEKK-SSFRKAFSHKKHGSKEPKRAGAA---GAASPESRRPRRPTYLPLCVGGHRPSISS 504
gi 345778412  422 QVQEPEVAVENLSLPYRRKSHEKK-SSFRKAFSHKKHGSKDQKRAGAA---GATSPESRPHRRPSFLPLCVGGHQPSTSS 497
gi 927156494  412 -VQEPEVAVENLAPVCRKKCQEKK-SSFRKAFSHKKHSFKETKRTGAA---GAASPESRPPKRPSFLPLCVGGHRASTCS 486
gi 296474536  404 QVQEPEVAVENLAPAYRKKCQERK-SNFRKAF-YKKHSSKDPKRAGAA---GAASPDSRPPKKPSFLPLCVGGHWPSVSS 478
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81899812   505 S--PESLEFQKTEAAGGAPAGSPGAPFQARSHTPDEGPSP--ERAWESKEFMIQKLVASLQEVDRDLGRQIRKYPSFKRF 580
gi 961729699  500 SpdLEDVEFQESSPAEETPVGSSDAPSQTRSHQPEGGPQP--DGVFESKELVIQNLVALLQEVDGQLGEQIRRHPSFKRF 577
gi 884925877  493 SsdGEEPEFLEPSAAEGAAPVFPEVASKASSCTPDGGPQPpqEGACKSKELIICKLVALLQEVDGELGKQIQRHPSFKRF 572
gi 532066185  482 SsdPEHSEFQEPLAAEGFPA----ASSQTRSHTPEGGALP--EDTCESKEGIICTLVELLQEVDGELGDQIGRHPSFKSF 555
gi 1040167312 442 SfdSEDPEFQACSPAARAPASFSEAAPQAGSHKAEGGHPL--DETHGSKELLVRELVALLQAWDGQLGKQIRRHPSLKMV 519
gi 1034175020 489 SldPEDLKCRERLPAEGEPVVISEAPSQARGHTPEGAPQL--SGACESKEIIIQKLVALLQEVDGQLGQQIRRHPSFKRF 566
gi 395832617  488 SldPECSEFQEPSPAEGGPVGISEAPSKARSHKPEGGPQQ--DGASEEKEVIIQKLVVLLQEVDGQLGQQIRRHPSFKKF 565
gi 940763761  505 SvdPEGPEFRESSPAEGGRVGSSESPSQARSHEPEGRPLP--DGACESRELVIQQLVALLPGVDGHLGEQIRRHPSLKKF 582
gi 345778412  498 SldLDGVEFRESLPTEGAPVRPSDAPSQTRGHKPEEGPQP--DEVFESKEMIIQRLADLLQEVDGQLGEQIKRHPSFKRF 575
gi 927156494  487 NpdLEDLEFQEFSPAEGSPGGCSEAPFQARSHKPEVGLQP--EGANESKELNIQKLVALLQEADGQLGEQIRRYPSFKRF 564
gi 296474536  479 DsdPEDLEFQGSPPTEGEPVGAPEALSQARSHKPEAGRQP--DGANESKELIIQELVALLQEVDGQLGKQIKRHPSFKKF 556
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81899812   581 FNEFSDASLRKLVATLERQKASLSEEGRSLANRPPPCAFGTLNKFAATRSCTICTLMQSRGEykGHSYAHFLSRKAEQDI 660
gi 961729699  578 FYKVSDSSLRKLAATLHSQKARSPELGRNLTKRPYQLAFGFTNKFASNNSHAVFSLMGLCYS--HASYTHFPYREAQQNI 655
gi 884925877  573 FYEFSDSALRKLVATLSSQQAHLADGDGGLPTRPFPFTLGLGSRYTDSHRRTICSLMGSRGG------AQTLSREAQPvr 646
gi 532066185  556 FYEFSDSTLRKLVATLRRRKTHSPGGARSLAQRPSPYAFGLVHKFAGSHSRTICSLMGSRGHcvQHNFTQFPSREAQPNM 635
gi 1040167312 520 FYEFPDSSLRTLVATLRSQEAPSPGSARSLVGKPYPFVLSLANKFAGNHSHASCRLMGSRGHccQHSYAHFPHTEGQLNI 599
gi 1034175020 567 FYEFSDSSLSKLVATLRSQVAHSSKLDRNRARRLYQFDVSLANKFAGSNSHAMCILMGLRDH---YNCTQFPYREDQPNI 643
gi 395832617  566 FYEFSDSSLNKLVATLCSQAAHFSELDKNLAKRPYQLGFGMANKFANHKSHAFSILMGLRSH---YSSTQFPYRESQLvr 642
gi 940763761  583 FYQLPDASLRKLAATLRRRGACSPAPCRGLPERPYQFAFDLANKYAGRSGHTALSLMGLR-------YPQLPHTEAQQNI 655
gi 345778412  576 LYRLSDSSLRKLAATLHSQQAHSTESDRKLIKGPYHFAFGLPNKFAGNNSHAVLSLMGLRYS--QHSYSHFPCREAQQNI 653
gi 927156494  565 FYRLSDSSLRKLVATLHCQEAHSAEPDRNLAEGSYPFVFDLANKPAGNNYQAVLSLVGLRYR--QSSYGQFPYREAQPNI 642
gi 296474536  557 LYEPSVSSLRKLVATLRSRGAHTTEP-----KRTYPFVFGLGNQGAGNNYHPVLSLTGLHYR--RPSYGQFPYEEAQQNI 629

                  ....*....
gi 81899812   661 TNLDSQSPD 669
gi 961729699  656 TNPESQSPD 664
gi 884925877  647 egakdggtr 655
gi 532066185  636 PSPECQSPD 644
gi 1040167312 600 TSPESQSPD 608
gi 1034175020 644 TSPEVESPD 652
gi 395832617  643 evgkgngsv 651
gi 940763761  656 TSLDFQSPD 664
gi 345778412  654 TSPETGSPD 662
gi 927156494  643 TSPQSQSPD 651
gi 296474536  630 TSSQIQSPD 638
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap