Conserved Protein Domain Family
zf-CCCH_3

?
pfam15663: zf-CCCH_3 
Zinc-finger containing family
zf-CCCH_3 family is found in eukaryotes, and is typically between 155 and 169 amino acids in length.
Statistics
?
PSSM-Id: 317966
View PSSM: pfam15663
Aligned: 11 rows
Threshold Bit Score: 189.645
Threshold Setting Gi: 340383798
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 752874033    1 MEhnHKNLDCYFFYYSTCKKGDFCPYRHEPSALGCETTCTYWQQGNCLNEHCNFRHMELKKNRKSIPCYWETQPGGCRKP 80
gi 351703924    1 MS--NRGEDCYFFFYSTCTKGNMCPFRHCKAALGNETVCPLWEEGRCFQPLCRYRHMRIDKKSSEISHYWENQPRGNQKL 78
gi 954442743 1267 MS--LHGDDCYFFFYSKCTKGDRCPFRHSKSALGTEIVCQAWLEGRCRKAGCGYRHMKNGKTRSTTPCYWENQPGGCLKQ 1344
gi 340383798   43 MN--PTAEDCYFYFYSTCSKGDKCQFRHCSAAIGNEEICQLWKEGKCKRQACAFRHSNSNRQRASIPCYWENQPSGCLKS 120
gi 637295392    1 MS--NK-DDCYFYYYSTCSKGNNCPFRHCEAALGNETVCVLWKEGRCFRSVCQFRHMEINKKRSEIPCYWEKQPLGCQKL 77
gi 686700417    1 MP--NQGEDCYFFFYSTCTKGDSCPFRHCEAALGNETVCTLWQEGRCFRQVCRFRHMEIDKKRSEIPCYWENQPTGCQKL 78
gi 827549340    1 MEspRKFNDCYFYYYSTCTKGDNCVFRHEPSALGCETMCTAWQQGKCTDKRCKLRHMELRKNRKQIPCYWENQPGGCRKI 80
gi 642920219    4 LEspKKNNDCYFYYYSTCAKGDNCTFRHEPSALGCETMCSFWKEGKCLNVHCNFRHMELRKNRKAIPCYWESQPGGCLKP 83
gi 768952984    1 MT--NRGDDCYFFYYSTCTKGDSCPFRHCEAALcSETVCTLWQEGRCFRNTCKFRHMEITHNRKEIPCYWENQATGCQKP 78
gi 765120518    1 MT--NHGDDCYFFYYSTCTKGDSCPFRHCEAAMGNETVCNLWQEGRCFRPTCKFRHMEITKNRKEIPCYWENQPAGCQKP 78
gi 47938839     1 MT--LQGDDCYFFYYSTCTKGDSCPFRHCEAAMGSETVCNLWQEQRCFRNVCKFRHMEIDKNRKEIACYWENQPAGCQKP 78
                          90       100       110
                  ....*....|....*....|....*....|....*..
gi 752874033   81 HCPFLHASPRNIT---NDPINPVKtTE-VATKSPNQE 113
gi 351703924   79 SCAFHRDRGPSVG---DLFLPPSK-TM-VPSALPSPE 110
gi 954442743 1345 HCVFMHLKPRDKSlsaADYSPPPQ-QT-KASKPckkr 1379
gi 340383798  121 HCPFKHFKPRP--------SPPSK-EErVKECIKIin 148
gi 637295392   78 NCAFHHTKGRFVD---GLFLPPSK-TA-IPNAFEPPE 109
gi 686700417   79 NCAFHHNRGRYVD---GLFLPPSK-TV-LPTVPESPe 110
gi 827549340   81 HCPFMHKNPEART----DGIAPSQpAP-PVHACLN-E 111
gi 642920219   84 HCPFLHQSPK-----------PAAaNE-SHESKTDSG 108
gi 768952984   79 HCAFFHEKPRYID---GVFVSPDK-Nvgknveqpqee 111
gi 765120518   79 HCAFFHEKPRCIQ---GLFVPPDQ------SQNKNEE 106
gi 47938839    79 HCAFHHEKPRIIN---GNYLAPDKgQV-ARKDNEEAP 111
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap