Conserved Protein Domain Family
GDWWSH

?
pfam15667: GDWWSH 
Protein of unknown function with motif GDWWSH
This family of proteins is found in eukaryotes. Proteins in this family are typically between 135 and 289 amino acids in length. There are three conserved sequence motifs: GDWWSH, RSDF and KRHG.
Statistics
?
PSSM-Id: 317970
View PSSM: pfam15667
Aligned: 9 rows
Threshold Bit Score: 278.669
Threshold Setting Gi: 156372397
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187659939  45 GRGRVYYAKFINTNVRTCNEPVPYIDVKKEPENQ-GDWWPHGKGLENPFQPPYDTKSTQRSDFKKPTCPLVSPVKHSKL- 122
gi 163916222  87 NMPHPYYARFLRDNSRFLKEPIPHMETASTKHIQ-SEWWPRDEEHVAPHKPSYDMMTTQRSDFLKFSYSSNPQTRYSAKp 165
gi 637258600  58 HNPQPIHAKFIKTNTKFLNEPVLYMETEDTKRKQ-GHWWPTHGAFMQRPKAPYDPKSTQRSDFQKPPCKLVPAIKYTK-- 134
gi 156372397  64 NKPQPTAVTFLRQNPRFICEPICHVDTSINTEELtHPWWPNESVERPVTQPHYTFDSTSRDDYRDTSSYIKQHKGYSRYn 143
gi 558102101  45 RRRRVYYAKFINTNARTCNEPVPYIDPKIGTENQ-DDWWPHGKEPEHHFQPPYDTKSTQRSDFQKPTCPLVLPVKHSKL- 122
gi 532072489  46 RRGRVDYAKFIITNARTFYEPIPYIDSKNKTEDQ-SDWWSYSKALEHVFQPPYDTKSTQRSDFQKPTCPLILPVKHSKM- 123
gi 348552318  45 RKGRVNYAKFIYTNARIYNEPVPYMDPKKEPEEQc-DWWSHDEALERGFQPLYDTQSTQRSDFQKPTCPLVLPVKHSRL- 122
gi 297667632  45 GRGRIYYAKFINTNARTYNEPVPYIDPKKGPEIQ-GDWWSHGKALEPVFLPPYDSKSTQRSDFQKPSCPLVLPVKHSKT- 122
gi 344291810  46 KRGRIYYAKFIHTNARTCNEPVPYIDPKRGPEKQ-GDWWSHGKVLEHSFQPPYDTKSTQRSDFQKPTCPLVLPVKHSRM- 123
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187659939 123 ------QKPSYGIVPLVSPDAS-AELQRNFKEHISFIHQYDARKTPNEPIRGKRHGVFVQ---TEIKPGSRPTVPERTEV 192
gi 163916222 166 -----cKSPVCGIVPFAPPRSR-TRLPRLLQEQISFIHNYNARSVTNEPIRGKRHGAFVW---TEIKTESGPAVPKGTNL 236
gi 637258600 135 ------RQPTHGIVPLTSPRPSpGSLPRLFQEQISFKHNYDSRATPNIPYQGKKCGTFVW---TQMKPER---VPEGTKA 202
gi 156372397 144 ydstsnSKPTVGLVPGCSTTAS----NPSVIEKISYEHQYNARLDPNHPIRGKRHGCFVWkvsTPVKSSGRSSRSSGPER 219
gi 558102101 123 ------QKPSCGIVPLASPNAS-TELQKNFIERISFIHQYDSRKIPSEPMRCKRHGVFMQ---IEIKPGSRPRAPQGTAA 192
gi 532072489 124 ------QKASSGIVPLASPDAS-AELQNKFTEYMSFIHQYDSRKTPNEPIRGKRLGTFVQ---REIKPGSRPIVPKGTEV 193
gi 348552318 123 ------QKPSCGIVPLACPDAS-AELQNNFIEYISFIHQYDARNSPNEPIRGKRHGAFVQ---REIKPGSRPAVPMGTEV 192
gi 297667632 123 ------QKPSCGIVPLASPGTS-AELQNNFIEYISFIHQYDARKTPNEPLQGKRHGAFVQ---REIKPGSRPTVPKGTEV 192
gi 344291810 124 ------QKPSSGIVPLASPDAS-AEPQSNFIERIFFIHQFDSRKTSSEXLRGKRHGAFVQ---TQIKPGSRPTVPKGTEV 193
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187659939 193 LLNASGSCSSEQSkKTEKGNSAESKMISPGLCRQNSQELL-ETKTHLSETDIRVAANASLRRPEKREKTAKVFQIAVVNA 271
gi 163916222 237 FLNTTGSHSLDQA-ETEKGNSGESSVTSPRRCSHGSQQMF-GSEIHLSKTDLGEGAKSNPSAADREQNKSGSSQTIGRKT 314
gi 637258600 203 MSCAPRGAGFLEEpKTEKGSSVGNGVTSSCLCLPESQETApDSDKHLSETDVGPGAKADPRTTEGGQESSEISQTNKMDV 282
gi 156372397 220 -RSVSYELTTDESiGMNNSVNARSSVLSASKSLSNPQEVScAVGKDKDSSSLAACQKDIGQEPEETLTKESVKKSSPD-- 296
gi 558102101 193 LLNAPGPCSSEQPqKTEKGNSAESKMTSPGVGQQTSPELF-ETKTPLSETDVREAATAGPTSPVRRESAAGA-PTTAADA 270
gi 532072489 194 LLNAPGLCSSEQPqKTEKGNPAGSRMISPGLCQQNSQELL-ET------------------------------------- 235
gi 348552318 193 LLNASGSCSSEQSkKTEKGNSAGSRMISPGLCQQNSQELL-ET------------------------------------- 234
gi 297667632 193 LLNAPGSHSSEQSkKTEKGNSAESRMISPGLCQQNSQELL-EPKTHLSETDVRQAAKACPSSPESREKTAGATQTTVGDA 271
gi 344291810 194 VLKAPGSRSSEQSrKTEKGNSAESRMVSPGLCPQNSQEPL-ESTAYLPETDAREAARARPRSPEREE-VAGVFQTTAVGV 271
                        250
                 ....*....|.
gi 187659939 272 LLTRHDPL--S 280
gi 163916222 315 LIPIGEKL--S 323
gi 637258600 283 SGPGEKPP--S 291
gi 156372397 297 -LRPQRPLpyS 306
gi 558102101 271 LITRHNPS--T 279
gi 532072489     -----------
gi 348552318     -----------
gi 297667632 272 LFTRHKPL--N 280
gi 344291810 272 LLSGQEPL--N 280
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap