Conserved Protein Domain Family
Mucin15

?
pfam15672: Mucin15 
Cell-membrane associated Mucin15
Mucin15 is a family of vertebrate mucins associated with the cell-membrane. The function is not known. Members of the family are typically between 284 and 335 amino acids in length.
Statistics
?
PSSM-Id: 317975
View PSSM: pfam15672
Aligned: 11 rows
Threshold Bit Score: 352.196
Threshold Setting Gi: 1019065066
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401067    23 GEEGQKTNT-------TE----STAEDLKTMENQSVPLESKanlTSDKENrETSNPKASNFSFEDPSNkTHE-TGFYSNL 90
gi 50401038    23 QKQNPRRNV-------TQ----HTIEDVKIMRNNSIHLERSinvTSENGS-DISNLMVTTPSPLNLST-TFRtTNSTRTW 89
gi 1019065066  23 GNNDMERGTevnppmhTQpplvKTKESYK--PSESINLRNYtvnTGGYDMsSTAPP-----------NgIKHtSHLPSDL 89
gi 675699178   62 GEENQDKST-------TQ----SIAEVFKTMENKPISLEGKanlNSEKENrTTSDLKASHSPPLNLSNkSHGiTDFSSNL 130
gi 831211310   23 GDENPEINT-------TQ----SIRESLKTVGNQPISLVSEatsNPNEKNlNTSNPITSHSPLLDLLNdMHAmKNISHNL 91
gi 884884491   23 ETENLEKNT-------TQ----STA-GIRKTKAQTLVLGTEakaNPDHGNrTVSIPRATASDt----------AASSRNL 80
gi 655603257   23 AKPNLEIPV-------AR----SIAEALKTMENQSISLASDtnlNSNTENrNNSNLKASISPFLNTSDkIHEiTDSSSNL 91
gi 558137665   23 GKERLEVNT-------TQ----NIAESLKDMAKEYVPLKTGadfNLGKDNrETSNPKARNSSLWDPSSkSDEtTDFVDNL 91
gi 731489064   24 GKENSEIST-------TQ----SNTEALPMMRNETFPLENE---KLDRENrETSNPNTSNFPVLDLLSkPHAeTTFSSDW 89
gi 752426874   23 GEESLEKNT-------TQ----SIAEGLKTMENKSVLLEGGtnlSSDKENrETSNPRASNSSFWDPSNkHHGtKEVFRNS 91
gi 545223078   23 G-EGLEINT-------TQ----SIAEGLKKIENESVPFGTEanlNSDKEYrETSFLKANNSSSWDPSNkIHRtTDSFNNL 90
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401067    91 STDNSSRSPSLMPTLSPrSPSTHSFVSKLPW-NSSIADNSLLPASAPPNTT-VPVSSENFTLSS---INDTMKAPDNSSI 165
gi 50401038    90 LMTSSSESSRPSSTYSV-PPLVQGFVSKLPL-NSSTADANPLQVSEHSNST-NSPSPENFTWSL---DNDTMNSPEDIST 163
gi 1019065066  90 ESDSTFWTPFNTSSSNPlSSTTVSSLSSVPTtNTTTLPGKLTTIKAHDNLN-TTVPTGHFTSSPspfTDNFTSTPSDNSS 168
gi 675699178  131 SAEHPSSSVKPTSTISTsPPLIHSFVSKLPW-NASIADEDPLPFSAHPNAT-PALSSEKFTWSL---ISDTTNTPDNSSI 205
gi 831211310   92 STETFSGTPKPTSMFSTtPVLVHGYVSKLPW-NASITDKNPLLVSS-PDTT-PTVPLENFTWSL---ANDTTKPPDNSSS 165
gi 884884491   81 TRGAFTAAVRPTAAFSTsPPLFHGFVSKLPL-NSSLAEKNLLPVSAHPNST-WTASLDNLSWSL---DNHTVYIPDNSSA 155
gi 655603257   92 AINNITESPRPTPTPSTsSPLIHGIVSRLPW-NSTIADEHFLPVSAHPNTT-SVVSSEKLPWSL---DNDTLKTPGNNST 166
gi 558137665   92 TTDN-PRSPRPTPVFSEsTSLIHSFVSKLPQ-NSSAGDENSLSVSPPPNAT-SAVSS---VGSL---ANDTMKT-DNSSI 161
gi 731489064   90 STDNSSGSLTPASTFSSsPPLVRGFVSKLPR-NSAVVNEHSLPVSGSPNATpSAVPSEKFTSSLntsTNDTMNAPDNSSM 168
gi 752426874   92 STNNFSRNPRPMPTSPTsPPLIHSFVSKLSW-NSSIADENPLPVSAVPKTT-SAISSEKFTWSS---ANDTIKTPDNSSI 166
gi 545223078   91 SPDNFTRSPRPTPMFSIsPPLIHSFVSKLPW-NSSIADENPLPASAPASAT-SAISSENVTWSS---ANDTMKTPDNSST 165
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401067   166 TVSNLPSGP-NTTSVTPMVTE--GWPTTTRESMEGFTVYQ---E-TTLHPTLKFTNNSKIFPNTSDPQEENRNTGVVFGA 238
gi 50401038   164 TVRPFPPPP-KTTPVTPFTAEptEWLPTNNDNFAGFTPYQ---EkTTLQPTLKFTNNSKLFPNTSDTPKENKNTGIVFGA 239
gi 1019065066 169 IL--------MTTHIPSVVTAtdSTLSESTTGINNSTTFNgslEtTTLQPGLNFTNSSKTQSNTSDSGKDTRNSGVVFGA 240
gi 675699178  206 TVSILSSEP-ASTSVTPLIVEpsGWLTTNSDGFAGFTPYQ---EkTTLQPTLKFTNNSKLFPNTSDPQKENRNTGIVFGA 281
gi 831211310  166 TVGLLPPEP-TSKSVTPGIVEqtGWLTTDSESFAGFTPYP---EkTTLQPTLKFTNNSKLFPNTSGPQKENRSTGIIFGA 241
gi 884884491  156 GISVLPPVPaANQPATPMTIEptGWLTADGDTFPDVT--------VTLQPTLRFTNNSKVFPSTSGPQKENRNTGVVFGA 227
gi 655603257  167 TVSILPPAP-TTKSVTPLTTEstEWLTTSSDSFAGFTPYH---EeTTLQPTVKFTNNSKIVPNTSDPQKENRNTGVVFGA 242
gi 558137665  162 TVSILPSAL-TTMR--PMTTEpdGWLNITNDSFVGFTPYQ---E-MTLQPTLKFTNNSKIFPNTSDPQEENRNTGVVFGA 234
gi 731489064  169 TVSILPPVP-TNMSVTPLIMEptTLLTTTSDSLAGFTPYQ---EtTTPQPTLKFTNSSKIFPNTADPQEENRNTGVVFGT 244
gi 752426874  167 SVSILPTAP-NTTSVTPMITEpdEWLTTSNESFIGFTPYR---E-TTLQPTLKFTNNSKVFSNTSDPQEENKSTGVVFGA 241
gi 545223078  166 TISILPSAP-NTMSVTPMTTEpdEWLTPTSDSSVGFTPYQ---EtTTLQPTLKFTNNSKIFPNTPDPQEENRNTGVVFGA 241
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50401067   239 ILGAILGASLLSLVGYLLCGKRKTDSFSHRRLYDDRNEPVLRLDNAPEPYDMSFGNSSYYNPTA-NDSSTSAGGENAHDS 317
gi 50401038   240 ILGAILGASLLSLVGYLLCGQRKTDSFSHRRLYDDRNEPVLRLDNAPEPYDVNFGNSSYYNPAV-SDSSMPEGGESLQDG 318
gi 1019065066 241 ILGAILGASLLSLIGYLICGRKKPDSFSHRRLYDDRNEPVLRLDNTSEPYDMNFGESSYYNPAVtDDAGVHDRPGSARDG 320
gi 675699178  282 ILGAILGVSLLTLVGYLLCGKRKTDSFSHRRLYDDRNEPVLRLDNAPEPYDVSFGNSSYYNPTL-NDSAMPKCQENAHDG 360
gi 831211310  242 ILGAILGASLLTLVGYVLCGKRKMDSFSHRRLYDDRNEPVLRLDNAPEPYDVSFGNSSYYNPAG-NDSSRPEGREDARDS 320
gi 884884491  228 ILGTILGVSLLSLIGYLLCGKRKTDSFSHRRLYDDRNEPVLRLDNTPEPYDGGFGGPSFYNPSV-NDCSMSEGPESTRDG 306
gi 655603257  243 ILGAILGASLLSLVGYLLCGKRKTDSFSHRRLYDDRNEPVLRLDNAPEPYDVSFGNSSYYNSTV-NDSSVPEGRENARDG 321
gi 558137665  235 ILGAILGASLLSLVGYLLCGKRKTNSFSHRRLYDDRNEPVLRLDNAPEPYDVSFGNASYYNSTV-NDSSIPAGQENARDG 313
gi 731489064  245 ILGAILGASLLSLVGYLLCGKRKTNSFSHRRLYDDRNEPVLRLDNAPEPYDVSFGNSSYYNPTV-IDSRMPEGPELARDG 323
gi 752426874  242 ILGAILGASLLSLVGYLLCGKRKTDSFSHRRLYDDRNEPVLRLDNAPEHYDASFGNSSYYNSTV-NDSSMPAGQENARDG 320
gi 545223078  242 ILGAILGASLLSLVGYLLCGKKKTESFSHRRLYDDRNEPVLRLDNAPEPYDVSFGNSSYYNPTV-NDSSLPAGRENARDS 320
                         330
                  ....*....|...
gi 50401067   318 IPMDDIPPLRTSV 330
gi 50401038   319 IPMDAIPPLRPSI 331
gi 1019065066 321 IPMGDIPPLRPSV 333
gi 675699178  361 IPMDDIPPLRTSV 373
gi 831211310  321 IPMDDIPPLRTSV 333
gi 884884491  307 IPMDDIPPLRTAV 319
gi 655603257  322 IPMDDIPPLRTSV 334
gi 558137665  314 IPMDDIPALRTSV 326
gi 731489064  324 IPMDDIPPLRTSV 336
gi 752426874  321 IPMDDIPQLRTSV 333
gi 545223078  321 IPMDDIPSLRTSI 333
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap