Conserved Protein Domain Family
Ciart

?
pfam15673: Ciart 
Circadian-associated transcriptional repressor
Circadian-associated transcriptional repressor (Ciart or Chrono) is a negative regulatory component of the circadian clock. It functions as a transcriptional repressor, modulating BMAL1-CLOCK activity. It also regulates metabolic pathways such as the glucocorticoid response triggered by behavioral stress.
Statistics
?
PSSM-Id: 317976
View PSSM: pfam15673
Aligned: 6 rows
Threshold Bit Score: 519.461
Threshold Setting Gi: 821484830
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115503690  85 SEVKRSRDGEQETSLNTQGCTTEGDLLFAQKCKELQGFIRPLTDLLNGLKMGRFDRGLSSFQQSVAMDRIQRIVGVLQKP 164
gi 821484830 102 SGMKRSRDSEEETCLNVQNPLTEGDRLFAQKCKELQGFIRPLTDLLNGLKMGRYERGLSSFQQSVAMDRIQRIVGVLQKP 181
gi 731468900 159 SRVKRSRDGELESSLNIQGCTTEGDLLFAQKCKELQGFIRPLTDLLNGLKMGRFERGLSSFQQSVAMDRIQRIVGVLQKP 238
gi 395856051  89 SGVKRSRDGELETSQNIQGCTTEGDLLFAQKCKELQGYITPLTDLLNRLKMGRFERGLSSFQQSVAMDRIQRIVGVLQKP 168
gi 348586349  92 SGMERSRDCDLETNLNIQDCTTEGDLLFAQKCKELQGFIRPLTDLLNGLKIGRFERGLSSFQQSVAMDRIQRIVGVLQKP 171
gi 612000673 251 SGMKRSRDNEEETCHNIQNPRTEGDRLFAQKCKELQGFIRPLTDLLNGLKMGRYERGLSSFQQSVAMDRIQRIVGVLQKP 330
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115503690 165 QMGERYLGTLLQVEGMLKTWFPHIAAQKSSSGGSRHQ-ISKHFPSHHGDPGAASPAPLLEKMGQTQLGHLvlkpkq---- 239
gi 821484830 182 EMGERYLGTLLQVEGMLKTWFPHVTSQKSPPEDGKHKiLSKRLASSQTHPTGPSADLPRREINQIQPRHLdqgkeklhsq 261
gi 731468900 239 QMGERYLGTLLQVEGMLKTWFPHIAAQRSLLGDNRHQ-LTKPLPSHHTNLAVSSPAPPMAKMNQTQLGHLvlkqkq---- 313
gi 395856051 169 YMGERYLGTLLQVEGMLKTWFPHIAAQKSLLGHSRHQ-LTKHFPSHHSDSAASFPVSSLEKVDQSQLGHVvlkpeq---- 243
gi 348586349 172 EMGERYLGTLLQVEGMLKTWFPHIAAQKSSLGGNRRQ-VTKHFQNHHSDSAAS---PPMGKMDQTHLGHLalkpkq---- 243
gi 612000673 331 EMGERYLGTLLQVEGMLKTWFPHVASQRATPGDGKHRlLSKRLASSQANPTGPSADLARKNLNQIQLRHLdqgkeklhsq 410
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115503690 240 ----pwhltGWPAMNLTWIHSTPICNPPLSSQGSAS-GHSPIGTGASIGVILVLQKGGQPFTHSAPGTPVPPTPLSPVVP 314
gi 821484830 262 eqesaqllpEWPAMNLTWIHTSPICNPPLSSLGSAAfSHGLLGPGTSFGVILFLQPGTQSLAYSAPTTPIPAATVSPVVC 341
gi 731468900 314 ----pwhltEWPAMDLTWIHTTPICNPPLSSPGTISlSHGPLGTATSIGVILFLQHGVQPFTHSAPATPVPPPTTSPVTP 389
gi 395856051 244 ----pchltDWPALNLTWIHTTPICNPPLSSPGTISfSHGPLGTGTSIGVIFFLQHGVQPFTHSTPTTPVLPTTASPVIS 319
gi 348586349 244 ----pwhltEWQAMNLTWIHTVPICNPPLGSPGTISfSQGPLGARTSIGLILFLQHGKQPFTHSAPTTPVPPTTASSAIL 319
gi 612000673 411 eqelpqllpEWPAMNLTWIHTTPICNPPLSSLGSAAfSHGLLGPGASFGFILFLQHGAQSFARSAPTTPVPYSAVSSVVC 490
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|.
gi 115503690 315 GDLKKLPGEEPRCHSLPVTLP-----SDWSCILCPPVLPTTDREMTKGHPE 360
gi 821484830 342 DGPKDLPEEGPRCYSLPASLAstsltSEWSPTLSPPCLPMVAKEVITRMDE 392
gi 731468900 390 GDTKKLSGEGPHCHSxTVTLP-----SDWNCTLCSPGLPTVTREMTMGHLE 435
gi 395856051 320 GDPKKLSREGPRCYSLPVTLP-----SDRSCPLSPPSLPIMAREMTVGHLE 365
gi 348586349 320 GDPKKLSGEGPRCHSLPVALP-----SDWSCKLSSTDPPAMAREMSMGHLE 365
gi 612000673 491 DGPKNISEEEPRCYSLPVSLSstpltSERSHSLSSPCLPTVTREKTPRMDE 541
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap