Conserved Protein Domain Family
CLLAC

?
pfam15675: CLLAC 
CLLAC-motif containing domain
This short domain is found in chordates. It carries a highly conserved CLLAC sequence motif. The function is not known.
Statistics
?
PSSM-Id: 317978
View PSSM: pfam15675
Aligned: 12 rows
Threshold Bit Score: 31.609
Threshold Setting Gi: 741901515
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                           10        20        30
                   ....*....|....*....|....*....|
gi 514469287    51 PWSLWKTCLVCLLACLIASAIAVLVLHFGH 80
gi 565317085    33 HWSLLHVFLVCLLASAVTTVVGVLILSLVY 62
gi 1022997679   79 HWSLLKIFLTCLLACIITTTIGVLILSLVK 108
gi 741901515    51 PRSPWKTFLLCLLACLIATALVVLLFYFVH 80
gi 533114678    51 PWSLWKTCLVCLLACLIASAIVALVSHFGQ 80
gi 344258926    50 PCSLWKIFLICLLACLVATAITVLALYF-G 78
gi 859770978    33 QWSLMSVFLVCLLACTVTTAVGVLILSLVY 62
gi 432101412   445 NWTLWNIFLACLLACVITTAIGVLIICLVN 474
gi 808154174    56 DWSMWKVFLACLLACVIMTAIGVLIICLVN 85
gi 953861620    82 NWSLWKFFLACLLACAITTAVGVLIICLVT 111
gi 511842546   278 DWSLWRIFLACLLACALTTTIGVLIECLVY 307
gi 483522205   317 NWSLMKIFLVCLLACVITTAIGVLVLSLVY 346
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap