Conserved Protein Domain Family
S6OS1

?
pfam15676: S6OS1 
Six6 opposite strand transcript 1 family
This family of proteins is found in eukaryotes. Proteins in this family are typically between 114 and 587 amino acids in length. The function is not known.
Statistics
?
PSSM-Id: 317979
View PSSM: pfam15676
Aligned: 9 rows
Threshold Bit Score: 775.933
Threshold Setting Gi: 620988223
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194225068  200 CVEDIKENKATICKIHETINTTDEEIGHYCKHSKEIKDNCSNWKPTCDVFHKHEDYMQDQFTIYQETVEKDKKMYHGYIC 279
gi 611971805   36 FCTNIKEKKRNIFTLRDKINTSDDEIDHYHKHNKYMKKDCINWMPTNDVLHKHEDYLQEQFQNHQETTEKDKKMYHDYMR 115
gi 821464038   36 FYKNIKEKKKSIFSLHDKINAIDNEITHCRKHNKYVKENCANWMPTYDILHKHEVFLEDQFQNDQETTEKDKKVYHDQMR 115
gi 620988223   37 CSAKVLESKKCILKLHENINKSDDEIVSYQKHKEHFKDSCINWKPTYDVLYKHENYLQEQFQKHQESTEKDKKMYHDYMS 116
gi 874496048   58 YSVKITEKRNEIARLKENINNSNEAIADLRKQNENSKDSCNAWKPTYAILSKHEEYLKNELEVLQEATENERKMYQDYII 137
gi 733890913   30 YSSKITEKRNEIARLQENLNNCNDAIADLRKQNENSKDSCNAWKPTYAILSKHEEYLKNELEVLQEATENERKMYQDYII 109
gi 1039742085  37 CLESIKENKANVSKLREAINKVDEDIAFHYKHSKEIKDSCSNWKPTCDVFHKHEDYIKDQLTAYQETNEKDKKMYHDYIC 116
gi 344273861   37 CFEDIKENKKIICKIHETINTTDEEIGYYCKHSKEIKDTCTNWKPTCGVFHKHEDYMQNQFTVYQETVEKDKKMYHSYVC 116
gi 861416134   37 CLEDIKESKETICKIHKSINKTDEEITHYCKHSEKIKDSCSDWKPTCDVFHKHEDYMQGQLTIYRETIEKDKKMYHGYIS 116
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194225068  280 QYKDVLKQYQLKYSETPFSHEYYEKKREHEEIQNRVLACTEQLKMNETIFMEFLVPAPFPSRTKWTLHIVNLRYKTQDIL 359
gi 611971805  116 QCNDTLKQYQLHYSESSFAQEYYKNKTEVEEIKSRIITCSEQCKIKETILMELIVPAPFKSLPDWALQIVHLRSKTEDIL 195
gi 821464038  116 QCKDVLKHYQLQYSKAPLAQKYYKDKTQVEELKNQILACNEQCTIKETILLELSVPAPFKSLSQWALQIVHLRIKTEDFL 195
gi 620988223  117 QHKKVFAQYQITYSERTLAKEYNRKKAEFEVIHNRVLSQTEKFKLKETTLMELLVPAPFRSLPHWALLIANLRYKTEDTL 196
gi 874496048  138 QYKEILEQHREKYAETPLAQECSKKKKEIEEIQNRILKQSEQYKLKEDACSDILEPAPFKSFNDWALHIASLRQKTQEML 217
gi 733890913  110 QYKETLKQHREKYAETALAQEYYKKRXEVEEIQNRIQKRSEQYKLKEDADLDVLEPAPFKSINDWALYIASLRQKTQEVL 189
gi 1039742085 117 QYEDVLKQYQLKYSETRFSCKYYEKKKEHEEIKNRVLACTEQLQLNETILMKFLVPAPFPSLTKWTLYVVNLRYRTQDIL 196
gi 344273861  117 QYKDVLKQYQLKYSEAPFSREYYEKKTEHEKIQNRVLACSEQLKMNETIFMEFLVPAPFPSLTKWTLHMVNMRCKTQEIL 196
gi 861416134  117 QYKDVLKQYQLKYSEIPLSRDYYEKKREYEGIQNRALACTEQLKTNEIMLKEFRVPASFPSLSKWTLYIVNLRFKTEEIL 196
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194225068  360 KLANNFSKSSSELKKEVDEMEIEINYLNQQIARLYETKNLSETLEEKN-KNIEKKKELKERIFEKDEQHiLTLNKAPQKS 438
gi 611971805  196 KYASTLICKSSTLKKEADEIERKINYLNQQTARISETKNLSKVLEDKS-DKIEKTKEFKERIFEEHGRI-CELNEDLQNS 273
gi 821464038  196 KCASTLIHKTCKMKEEIEEMER-----NQETERISEAKNLPEVLEEKN-KELEKTKECEGRIFEEHGHF-RVLNENPQSS 268
gi 620988223  197 KQAASVTQKSLLLKKESEEMETKLRSLKNQVVQFSEVK---KPIENTE-KKIEK-NPFKSRISEGLERR-RRYQRN---R 267
gi 874496048  218 KLAEVATQESVELEREAEELEMKINYFKKRFEETTEDQNDSEMVEGKNlKSLEKPKNFKERIFEESEHPsLLNEKHQLYK 297
gi 733890913  190 KLAETATQESTELEKEADEIEMKINYFKKTFEKTTEDQNNSEMIEGKNlKSLEKPKEFKERIFEESEHPsFLHEK-QLYK 268
gi 1039742085 197 KRANNFTKRSFELEKEADDMEIEINSLNKQMARLFESKTFSEALDEKN-KNTEKRKEFEERIFEKDEQ---VSNRSSQNS 272
gi 344273861  197 KLANNFTRSSSELEKEVDEMEMEINYLNqQIARLYETKNLSETLKEKN-NIIEKRKELKERIFEKDEQg-LVLEKKHQNS 274
gi 861416134  197 KHANNFTKNSSQLKKAINEAEIEINYLN-KIIRLYESKNLSETPEENH-KNTEKRKELKERIFEKDEH---IFSETPQSS 271
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194225068  439 QLFLPYESQKLVRPI--KMHSSEPKVIDKKEESSVKQSKLANIDFR--QKENDTQVFNDSTVNNHskcSHVAAIKSSQNF 514
gi 611971805  274 KLFLPYNSQKLVKPVgnERHFPEPRGTDKKEESSLSYSTLAKIDFRpeRKATPTPEFDESMMNKY---SQVSSLKSTQNL 350
gi 821464038  269 QLFLPYNYQNLVRPVrnDRHFSEPGGTDKKEGSS-SHSTLARIDIR--PERKEILEFDVSVMNKY---SQVSPHKSTQNL 342
gi 620988223  268 KVFPLFSSLKSVRPKkrSKPFLELRKPGKRGVRSSGSSSLARISVN--QEENEGKECNDSAVSKLskyDQLAASVNLQEL 345
gi 874496048  298 PLHLPCIPRKSVQSVqtIRFSMKRMDKGREEKEKHMEHSLATSSSSs-HAENPSQMVMDTAWTNNlqiAQVPSTASLQSQ 376
gi 733890913  269 PLQLPCIPRKSVQSLqtTRFSMQQTETGREEKENPMEQAVAASSSSs-HAENPSQMVIGTAATTNlqvAQVPSIASLQSQ 347
gi 1039742085 273 QLLLPCESQKFVR----NMNSSEARVTDKKEESSANQSKFVRSDVR--QKENNPQIFNDSGMDSNsksSHIPAVKSSQGF 346
gi 344273861  275 QLFLPYESQKFIRPV--KMHSSELRVTDKKEEGSV---KLANVDFG--QKENDRQIFNDSAVNNHskcSPVPAIKSLQNF 347
gi 861416134  272 QLYLPYESQKLVRPI--KMQSSEPKVTDKRAESSVKQSKLATMDFR--QKENNTQVSSDSDVNNN---SHVTTIKSAHSF 344
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194225068  515 MQFRLLTPQKQSNCNQWFEK-----G-DTDA-----ECGDKGTVR--QLRESKCASQVLYAEHFGKPIEDNSDE-VEERA 580
gi 611971805  351 LQLRLLTLQKQSDYKLMFDK-----G-STDS-----EGGIKETEK--KLKDSTDTLQGGHTEYLGKSVEDNHDK-TEGSP 416
gi 821464038  343 MQFRLSCLEKQSNYKQTFDK-----G-NTDS-----EYGKKETER--ELKDSAVLPQDSHTEHMDKLVEVSHDE-TEENT 408
gi 620988223  346 LQFRNPTAQKPSNYKKSFDR-----G-ERDA-----ECQDENPKR--AVNDSTCISHDTSAENFGESKEDYPVA-VYKNI 411
gi 874496048  377 MQFRQGVPPKQVTTNQQFESedtaiE-DQEA-----KCDDKEAED--EPKDSSYIPQKIHT--YFKSNENNPDT-AEESA 445
gi 733890913  348 MQFRLQRPPKQVTANQQFES-----E-KNVIenqeaKCDDKE--AadEPKDSSYIRQDTRT--YFKPNENNPDTaAAEGA 417
gi 1039742085 347 MQFRL----NQPNYNQRIEK-----E-HIDA-----ECGDKETVR--QVRESKCSTQALYIEHFGKSIENNSVE--EERD 407
gi 344273861  348 MQFRLL----TPQKQSDCHQwf--eKgDTDA-----ECGGKETVR--KLRESKCTSKAIYSEHFGKPVENKNNE-VEERT 413
gi 861416134  345 MQLRL-TPQKQSNYNQWFEK-----G-HTDA-----ECGDKGTGR--QVRESKHTSQGVCTEHSGKSIENNSDK-VEEMA 409
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194225068  581 ENFPRTPEIPLFLRTPEAVKTPES-LEKLVFPKTPTFEInrNRNTIPEGQTQKESPGFSFIMSyTSRSPGLNLFDSSIFD 659
gi 611971805  417 EKLTSTPEMPQFLRTPDFLKTPEH-GEKLEFSKSPSSEL--LRNIGLEGKSQKTPPAFSFLMG-SSVSPGFNLFESSDFG 492
gi 821464038  409 EKFPSTPEMPPFLRTPEFLRTPEC-VEKLEFSKSPSSEL--LRNIGFEGKTQKTPQAFSFLMG-SSISPGFNLFESSEFG 484
gi 620988223  412 EQFPCAPKSSSVGRNTEILRTSEStVMEGQLPLTSPFVL--DQNIDSEGPNQDASPTIPFFLTsATQSPGFSFFDSALFT 489
gi 874496048  446 EHFPRTPE------TPEFVGTPDSkGKKTQFSKTPPFDF--IHNFGCEEGTSK-SPAFFSLMNfSQKSPGFNLFDSSVFG 516
gi 733890913  418 ERFLRAPE------TPEFVGTPDSkGKKTQFSKTPPFDf--IHNMGCEEATSK-SPAFFSLLGiSQKSPGFNLFDSSVFG 488
gi 1039742085 408 ENFPQTPETPSFLRTPEALKTPES-MEKMQFPKSPFFEI--TKNATSEGHKQKDSPGFSFLMSyTSRSPGLNLFDSSVSD 484
gi 344273861  414 ENFPKTPEIPLSLRTPEAVKTPES-LEKLQFPKTPSFEInrNRNIVPESQTQKESPGYSFLSSyTSRSPGLNLFDSSIFE 492
gi 861416134  410 ENIPQTPDIPIFLRTPEAIKTPES-LEKIQLPKTPSFEI--NRNVVPEVQSQTESSGFSFLMSySSRSPGLNLFDSSIFD 486
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 194225068  660 SEISSDQFNE--HSAGNLNPLSSQQEIGNLFGKPEGEDGFTFSFPSDSSTHTFGAGKDDFSFPFSFERDQNST-PSSVKG 736
gi 611971805  493 NENLPDQFDEn-YSSENLNPVSSQKDIGGLFGKLEGEDTFPFPFSSEASTQPFEDGKDDFTFSFSFEQDQHSShSSSSKG 571
gi 821464038  485 NENLPDQFDEn-YSSGNLNPVSSQKDIGGLFGKLEGEDTFTFPFSSEPSTHTFGDGRDDFSFSFSFEQDQRSShSSSNS- 562
gi 620988223  490 GD-SPNQFAEn-YSAENFNRGSSQKDIGDLFGKLE-EDTFTFAFPTESSTHKFEGGKDDFSFSFPFESDQSLQpCSST-- 564
gi 874496048  517 AEHSSDETDDn-YPVGHLNPMSPQKDFGSLFGKSESEDAFAFPFPSDSTSHAFGDGKDDFSFPFAFGQDQRSSqSPSVQG 595
gi 733890913  489 AENSSDEIDEg-YSVGNLNPMSPHKDFGSLFGKSESEDTFAFPFPLESTSHAFGDGKDDFSFPFAFGQDQRSSqSPSVKG 567
gi 1039742085 485 SEISSDQFNEh-YSAVNLNPSSSQQGIGNLFGKSEGEDAFTFSFSSDSS-HTFGAGKDDFSFPFSFEQDPSTMtSSSSKD 562
gi 344273861  493 SEISSDQFNEr-YSGANLNSLSSQQEIGNLFGKSEGEDAFTFTFPSDSSTHTFVAGKDDFSFPFSFEQDQNVTySSSLKS 571
gi 861416134  487 SEMSSDQLSEhrHSAVNLNPPSSQ-EIGNLFGKR--EDAFTFSFSSDTSTRTIGAGKDDFVFPFSFEQDKNSI-PSSSEG 562
                         570
                  ....*....|....
gi 194225068  737 fSSSSQNTTQFTFF 750
gi 611971805  572 -FPSSQNTKQFTFF 584
gi 821464038  563 -FPSSHNAKQFTFF 575
gi 620988223  565 --SSPQTTKQLIFF 576
gi 874496048  596 fHSSLQNTKPSTFF 609
gi 733890913  568 fHSSLQNTKPSTFF 581
gi 1039742085 563 f-SSSQNKTQFMFF 575
gi 344273861  572 fPSSSQNTTQFPFF 585
gi 861416134  563 fSTSSQNTTQFSLF 576
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap