Conserved Protein Domain Family
OFCC1

?
pfam15680: OFCC1 
Orofacial cleft 1 candidate gene 1 protein
This family of proteins is found in eukaryotes. Proteins in this family are typically between 125 and 276 amino acids in length.
Statistics
?
PSSM-Id: 317983
View PSSM: pfam15680
Aligned: 11 rows
Threshold Bit Score: 138.812
Threshold Setting Gi: 992224919
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 992224919    50 KLEQKALKQPKQKKSKSAEFLMER-EEQEeenrerrVMKGIVNPGFLS-REEEEEEkdeaeersgggggggQRKEEGREI 127
gi 617385972     7 KLQQKALQQPKQKKSKSAEFLMGS-EERA-------AVVGIENPAFNGeGSAALSN---------------SPSWLGRKM 63
gi 973132705     8 KFQQKALKQPKQKKSKSDEFLMGEgEERA-------AAEGIENPAFNS-SSTDLSA---------------YQASEEREM 64
gi 1033366544    5 KFQQKALKQTKQKKSKSAEFLMGE-NEGV-------ATEGTANPAFNI-SSINLSA---------------YQTSEVDVI 60
gi 256818800     5 KFQQKAVKQTKQKKSTSAEFLMVK-EYTD-------ATEGAGNPGFNM-SSPELPA---------------HQTPQEKVV 60
gi 149045153     5 KFQQKAVKQTKQKKSTSAEFLMVK-EHTE-------ATEGAGNPGFNM-SSPELSA---------------HQTPKEKVI 60
gi 585155399     5 KFQQKALKQTKQKKSKSAEFLMVK-EDRE-------TMEGIGNPAFNM-SSPDLLA---------------HQTSDKRVI 60
gi 1003751962    5 KFQQKALKQTKQKKSKSAEFLMVK-EERA-------ATEGIENPAFNI-SSTDLSA---------------YQTSEEEVI 60
gi 171544951     9 ksqqkalQQPKQKKSKSAEFLMGS-EESD-------TVVGIDNPAFDGeGSTELSI---------------PSTWLGRKM 65
gi 551522340     7 KLQQKALQQPKQKKSKSAEFLMGS-EERA-------AVVGIENPAFNGeGSAALSN---------------SPSWLGRKM 63
gi 620978091    13 KFQQKALKQTEQKKSKSAEFLMVK-EYEA-------ASEGIENPAFNS-SSMDLSA---------------YQTSEGQVI 68
                           90       100       110       120       130
                   ....*....|....*....|....*....|....*....|....*....|
gi 992224919   128 GGDRQDSTLAAHQQQTELEAPANARGNEGARNYFDPSAAAQGDPRRCRMA 177
gi 617385972    64 RGDRPDSTLAAHQKKLELQAPASERGNERVRNYFDPPPPEQTDPRQCEMA 113
gi 973132705    65 KDDRQDSTLAAHQQKTGLHVHTKPRGNERTRNYFDPPLDEEINPRRYGAE 114
gi 1033366544   61 RCDKMDSTLVACQQKFKQQARSEPRGNECSRNYFDPLMDEEINPRQCGME 110
gi 256818800    61 RHDMLDHTLATHQQKSRLPASAGPKGNEYSRNYFDPLTEEEINSRQCRME 110
gi 149045153    61 RRDVPDHTLAAHQQKPRLPASAGPKGVTSV-----PIMLTlgdaycsshp 105
gi 585155399    61 RYDMPDHTLAAHQQKFGLLASAEPKGNEYSRNYFDPLMDEEINPRQCGME 110
gi 1003751962   61 RHDKLHSTLAAHQQKLRLQAHAEPRGNEYSRNYFDLLMDEEINPRQCGME 110
gi 171544951    66 RGDRPDSTLAAHHKKMELQAPAKERGNEHAQNYFDPSSAEQIDPRHHWTT 115
gi 551522340    64 RGDRPDSTLAAHQKKLELQAPASERGNERVRNYFDPPPPEQTDPRQCEMA 113
gi 620978091    69 GRDRLSGTLEAHQQNLSLPAPTESRGNEYSRNYFDPLMDEEINPRQSGME 118
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap