Conserved Protein Domain Family
NRIP1_repr_4

?
pfam15690: NRIP1_repr_4 
Nuclear receptor-interacting protein 1 repression 4
This domain is the fourth (C-terminal) repression domain of nuclear receptor-interacting protein 1.
Statistics
?
PSSM-Id: 317993
View PSSM: pfam15690
Aligned: 9 rows
Threshold Bit Score: 443.851
Threshold Setting Gi: 557021628
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 637326994  854 SKSHSTIPKKRKLHC---EPCESPLkivK---CNRSNVS-ETAGNH-K---SSPDVMYGTALKQKELKFSRTDLELKYSS 922
gi 149637067  852 PRSLCTVPKKRKLQP---EPGESPL---R---KTKGPTS-DVTNHPrP---STEPPHYGPTSHQDEVKLSRSELEPKYLA 918
gi 565314726  824 SKSHSMLPKKRKLHS---DSLEGPL---KilkSNKGKIS-DVTINH-K---TTADALYGSCLNQKESKFIKTDFEIKYSS 892
gi 545550837  842 ARTLCVVPKKRKLYS---EPLENPF---K---RMRNSVA-DAADSH-G----APEGLYGPPLSQQELKCSRSDLEFKFPG 906
gi 557021628  864 leSPCTVPKKRKFCSvfrNPPENYYd--K---KLKTNDAlEVVNGH-GlfmGTSPEFSG---DQQEIRCIRNELQFRPVT 934
gi 823453536  851 SKSLCTVPKKRKLHA---EPLESPL---K---KMKSNVS-DAGNNH-A---SPTEALYGPLLNQQELKFSRSDAEFKYAV 916
gi 147899732  836 TKIHCTVPKKRKMHQh--EPLESQV---K---LAKLSPS-ESGHYY------SPPPLSGPMFLQDETYSNKSGMDPRCNL 900
gi 297287776  846 SKNLCMVPKKRKLYT---EPLENPF---K---KMKNNVV-DAANNH-----SAPEVLYGSLLNQEELKFSRNDLEFKYPA 910
gi 395528964  850 SKSLYTVPKKRKLHI---EPSESPFk--K---KMKSHVS-DGANNH-----NPSTELYGPLLNKQEMKCNRNDLEFKYPA 915
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 637326994  923 GYGSNNESESRSWSRESKGFNVLKQLLLSENCEKDMSQRRNNsAVID--GRKKANKNNITNNnKGESSVSSLHTLVGNPG 1000
gi 149637067  919 APGSSTESDNRSWPRDSKGFNVLKQLLLSENCVRDLSQPRGG-AVPE--GKRKGARSGGPNG-KPEFSMAPLNGLMGAPP 994
gi 565314726  893 GYVSNNESENRSWSTESKGFNVLKQLLLSENCEKDMSQHRNNlSVMD--SKKKGSKHNLTNNdKAEFSVSPMHTLIGNPG 970
gi 545550837  907 SQGPAGDAEHRAWARESKSFNVLKQLLLSENCVRDLSQHRSG-SAGE--GRRKGHRGAAGGG-KPELSIPALDGLLYGPA 982
gi 557021628  935 DNSVNMVNEPRSGSKESKGFNVLKQLLLSENCVKDMSQPRNVaSSADncDMLKDGRDMDAAN-KTKVSGPYSNDSVCSHN 1013
gi 823453536  917 SHGSNSETENRSWSRDSKGFNVLKQLLLSENCERDLSQHRNN-ILTE--GKKKGNKTSATIN-KPEFTISSVRSLVGSPV 992
gi 147899732  901 TQNSLNEGKHLGWSRESKGFNVLKQLLLSENCVRDLSQHRNN-ILVD--DMVKGNRSHLAGS--SDFVTPPLNVHMGKMS 975
gi 297287776  911 GHGSASESEHRSWARESKSFNVLKQLLLSENCVRDLSPHRSN-SVAD--SKKKGHKNNVTNS-KPEFSISSLNGLMYSPT 986
gi 395528964  916 CHGSNNEHENRSWSRDGKGFNVLKQLLLSENCVRDLSQHRNN-TLTD--VKKKGNKNNVINS-KSEFSISSLNGVMNHSS 991
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 637326994 1001 QQTNCLDHQAFQ--------------YSVAVKSPASSPF---SDQLGGTVsS-HPECDQYSVCPV-PNE-RGPIKWIITD 1060
gi 149637067  995 QANSCVENRTFQ--------------YPVAVQSPASLPF---HEHLGCSA-P-RQESGQLSVCPV-PGD-KGPIRWVITG 1053
gi 565314726  971 QPSNCLDYQAFQ--------------YSVAMKSPASSPF---TEHLGGTV-SsKPECDQFSICHV-PNE-RGPLKWVITD 1030
gi 545550837  983 QPGGCGDSRTGPgprpgpgpgphprtCPCPARAPSSPPF---PEPGGCAG-S-RPEPGPANGCAGgAGD-KGPIKWVIAD 1056
gi 557021628 1014 HQNLGLDPKVYQ--------------YPFNMRSPTHSPF---PEHLGSQV-L-NIESAPFNLVPT-NNDtEGPIRWVIRG 1073
gi 823453536  993 QQNNCVDHRTFQ--------------YPVAVKSPASSPF---PEHLGSTV-S-RLESDQFSMCSV-PSE-KGPIRWVITG 1051
gi 147899732  976 NQTNSLGQMTFQ--------------CPSTLKNSPHPP----SDSLIHKT-S-RTESGQINMCPV-PND-KGPIKWVITG 1033
gi 297287776  987 QPSSCMDNRTFS--------------YPGVVKTPVSPTF---PEHLGCAG-S-RPESGLLNGCSM-PSE-KGPIKWVITD 1045
gi 395528964  992 QLNNCIDNGTFS--------------YPVAVRSPSSSPFqcsPEHLGNAV-S-RQESGQLSVCPI-PSE-KGPIKWVITG 1053
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 637326994 1061 SDKN-EHGRDSPRLTKTNPILYYMLQKGG-----SSVNIQEAHSKDSWSETSFTENSSAATIKRELSPVVECRMPFHAVR 1134
gi 149637067 1054 VDKS-DYEKDSPRLTKTNPILYYMLQKGG-----NSTCSQEVPDKDMWNESPFAESPAQMAIKEEFLPGAETKAPFLNLR 1127
gi 565314726 1031 SDKN-DLERDSPRLTQTNPILYYMLQKAG-----NPINIQEAHSKDAWRDKSFIENSSSVTMKKELSPVTECKT-FPNRR 1103
gi 545550837 1057 ADRN-GYERDCPRLTKTNPILYYMLQKGG-----GPVAGRDTQDKDAWGEPSSAESVAQVTVKEEFVPAAETRAAGFSLR 1130
gi 557021628 1074 VDRNhEFSKDSPRLTRTNPILYYMLQKGAascsvNSEGAERPATKNYKAESLSSESRTQLRVKEEPALNRETNTVFLDLR 1153
gi 823453536 1052 MDKN-DYEKDSPRLTKTNPILYYMLQKGG-----SSVSSQEAHDKEIWNEPSFTESSTRVTIKEELTSDTELKTPFSNLR 1125
gi 147899732 1034 MEKN-DVGKDSPRLTKTNPILYYMLQKGA-----HSAGGQELRDRGSWTA-SLLGNATEMTLKREMV----------NCR 1096
gi 297287776 1046 VEKN-EYEKDSPRLTKTNPILYYMLQKGG-----NSVTSRETQDKDIWREPSSAESVSQVTIKEELLPTAETRAAFFNLR 1119
gi 395528964 1054 MDKN-ECEKDSPRLTKTNPILYYMLQKGG-----NSVSNQEAHDKDIWNE-SFAKNASQVTVKEELLPAAETKVSFFNLR 1126
                         330       340       350       360
                  ....*....|....*....|....*....|....*....|....
gi 637326994 1135 HAYNNHSSNRVSLQ-------H-NVNGDVYGLLEKVLTIKKEPE 1170
gi 149637067 1128 GPYGSPLGSKAPRP-------H-NTNGEIYGLLEKVLTIKKEAE 1163
gi 565314726 1104 NAYISHS-NNMSIQ-------H---NGEVYGLLEKVLTIKKEPE 1136
gi 545550837 1131 GPYSSPPGRSAPRP-------H-SANGEGYGLLGNVLAIKKEAE 1166
gi 557021628 1154 NSY-SHLESKKPDQ---------NLNG-VHGILEKVLAIKREPD 1186
gi 823453536 1126 SPYNSHMGSNTSHQ-------HgGVNGEVHGLLEKVRTIKKEPE 1162
gi 147899732 1097 GTTPNGSGMMKTTTpvvnktlH-NSSGNKYGLLD-ILAIKKEPE 1138
gi 297287776 1120 SPYNSHMGNNASRP-------H-SANGEVYGLLGNVLTIKKESE 1155
gi 395528964 1127 SPYNSHMGNVASHP-------H-NTNGEVYGLLEKVLTIKKESE 1162
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap