Conserved Protein Domain Family
RAD51_interact

?
pfam15696: RAD51_interact 
RAD51 interacting motif
This motif interacts with RAD51.
Statistics
?
PSSM-Id: 317998
View PSSM: pfam15696
Aligned: 23 rows
Threshold Bit Score: 33.0318
Threshold Setting Gi: 0
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30
                  ....*....|....*....|....*....|....*....
gi 68565904   293 GSRNSSSNALAGTPAKSPSQSLRLGLSRLAPVKRLHPSA 331
2_pfamImport    1 ---GASNNFMKCASVKSPTQCLRLGLSRLARVKPLHPNA 36
7_pfamImport    1 APVGSVKHSLEGVTVKSPSQGLRLGLSRLARIKPLHPA- 38
16_pfamImport   1 AQVGKSPTSSQTPAVKSPSAGLRLGLSRMVRVKPLHPSV 39
5_pfamImport    1 -GSLLSNGIVRLYPLKTCSGPIRIGLSRRAKAKQLHPYL 38
6_pfamImport    1 RGSYFPHGISRVRPLKTCSRPIRIGLSRKARVKQLHPYL 39
21_pfamImport   1 AGSSFSYGISRVLPLKTCGRPIRIGLSRKAKLKQLHPYL 39
15_pfamImport   1 GGSHVSHGISRVQPLKTCSRPIRVGLSRRARLKQLHPYL 39
gi 123888108  306 GMVGRSPGASQNGSLKSPGQGLRLGLSRLARVKPLHPNV 344
10_pfamImport   1 GRSPSSSSP----ASKSPGQGLRLGLSRRVRVKPLHPSV 35
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap