Conserved Protein Domain Family

pfam15696: RAD51_interact 
RAD51 interacting motif
This motif interacts with RAD51.
PSSM-Id: 406187
Aligned: 19 rows
Threshold Bit Score: 52.3123
Threshold Setting Gi: 344242399
Created: 21-May-2020
Updated: 7-Aug-2020
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
XP_007503820  332 ASSGGSSNPLGGVSVRSPSHSLRLGLSRFARVKPLHPTA 370  gray short-tailed opossum
XP_003734836 1106 RGSYFPHGISRVRPLKTCSRPIRIGLSRKARVKQLHPYL 1144 white-tufted-ear marmoset
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap