Conserved Protein Domain Family
Phosphatase

?
pfam15698: Phosphatase 
Phosphatase
Members of this family have phosphatase activity.
Statistics
?
PSSM-Id: 318000
View PSSM: pfam15698
Aligned: 23 rows
Threshold Bit Score: 345.427
Threshold Setting Gi: 503902495
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81717783   12 LVDHLVRTRIAGDVATPRENNLSHYRKLANGDRNYWLGLELGDRWSdEQDVLAVMAERCGVNDDPEYRYGQDTIDPELTV 91
gi 123628747   9 LIDYLVTTGIAGQVATPRQNNLKHYRRLVEGDPYHQFGLTFQRKWT-FSDVLALMAQRCGVVADEDYVQGIDTIDPDRTV 87
gi 503908614  12 LVDHLLRTRIAGDVATSRENNLDHYRELAAGNRYYWLGLDLGTRWTdEDAVLELMAQRCGVVADRDHRAGQDTIDPQLTV 91
gi 502617876   9 LREHLIRTMIAGDVATPRQSNLLHYRRMAKGDPYYRFGLDLKRSWT-EREVLEMMVRMCGVNPDRMHLYGDDTIDPDKTI 87
gi 501366167  11 LARYLDRSRITGAVATPREANLRNVQGFLDGDQHQHMGVERTREWD-FDSVFGLMRDRVGINDDPSYVSGQDSISAQLCV 89
gi 503162933  10 fAAYLDSARITGDVATPRENNLSHIQGFLDHNEHLEFGVTWSKDWT-YDEVFEVMVRRVGLNPDRSHVQGQDTIGAAQCI 88
gi 407304908  16 LRKHLLKAKIAGEVATPREGNLAHYRRMVDKDPAYQFGLALK-DWT-FTETLAMMAQLCGVNPDPRHRHGQDTIDPELTL 93
gi 502921018   9 LITYLVRTGIAGHVDTPRQNNLRHYRRLVQKDPYHQFGLTFSHDWT-YSEVLALMSKRCGVVADEEYVWGIDTIDPDLTI 87
gi 270505282  18 LREHLVRTRIAGDVATSRENNLDHYRSLSNRDPHHMFGLTLEGHWA-YRDVLALMAKSAGVVADPEHREGQDVIDPDRTI 96
gi 504846665   9 LVEHLVRTRIAGDVATPRDNNLSHYRKLANGDRHYWLGLELGDRWTdEQDVLAVMAERCGVIDDPAHRTGQDTIDPELTV 88
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81717783   92 DALDRMAARLRKAAA-GRQRVLFATGHPGGLLDVHRATAAALRTAGCEIV--------VIPEGLQT-DEGYVWQLAD-VA 160
gi 123628747  88 DALEVVAERLAQAAR-DRERIMVATGHPNNLAELYRAWKDVLVDHGCTVVtaaagysyDAPGGPPP-TRRTLVWRDD-VG 164
gi 503908614  92 DALDRMAVVLRKAAA-GRQRVLVATGHPGGLLGVHQATVAALRQAGCEIV--------AIPEGLPA-DDGRVLQISG-VA 160
gi 502617876  88 DALERMAERIGQAAR-RREKVVLATGHPATLMPIYLALGRALRERGCTVLtpaagwsyAAEVGTSApQRRRIRYEEGmVA 166
gi 501366167  90 ARLDEYAEIFSRAVQ-GRKRLLFATGHPSGLAPVYARLARVARASGARVI--------RFDEALPF-EDGDVRQIED-VV 158
gi 503162933  89 DALEEYARIFGDAVR-ARQKILFATGHPAGLFPIYAELARVAERAGATVL--------RIEQGERF-LDGDIRQIMG-VV 157
gi 407304908  94 DALDAMGARIGRAAD-RQETVLLATGHPGPLMGVYRAIEDALRGNGCTVLtpaagwsyRIATPNGA-ARREIVYTSR-VA 170
gi 502921018  88 DALEAFADRLALAAE-RRERVLFATGHPRNLRETYRAWKDALAERGCQVLtagggysyEVTTERPP-NRRIVVWEDD-IA 164
gi 270505282  97 DAVEAMGDTIAGVLRtGGPRILFATGHPTGLLTIHMALARLVREHGAILMgpae--gwsyWSAGFG-RKRQIRYMDD-VA 172
gi 504846665  89 DGLERMAARLRKAAA-GQERVLFATGHPGALIDVHSRVAAALRAQGCDIV--------RIPGGLVA-DEGYVVQFAD-VA 157
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81717783  161 MLE-HGASLWHTHSGEPMRAVLNGLER-----------AGRPLPDLVVADHGWAGCAG-QLGVDSVGYADCNDPALFLAE 227
gi 123628747 165 MVT-DGTEPQHSHHPFAMRAVLAQLSE-----------TGGPWPQLVIADHGFAGAAG-EAGVPTIGFADSNDPALFLGE 231
gi 503908614 161 MVL-RNAALVHTHSPEPMTAILDALEG-----------SGRPLPHLVVADHGWAGCAA-QRGIDAVGYADCNDPALFVGE 227
gi 502617876 167 ALEdDDGRLHHTHDPFPMEAMLSEAAGtsngsdsstpaESKNWPDLAIADHGWAGAAG-QAGIDTVGFADCNDPALFAGE 245
gi 501366167 159 MVE-QYGGLRHTHFPEPMRLVLEHLQE-----------QGRQAPDLVIADHGMAGWAGsRAGLPTIAMGDCNDPGIFVAE 226
gi 503162933 158 MFE-QYGNLQHTHFPGPMRIALAQLRE-----------RGE-LPDLVVSDHGMAGYAAsQQKLLTLGIADCNDPGLFIAA 224
gi 407304908 171 ALG-TNGYLKHTHDPQPMQAMLHELAD------------GAGWPDLVVADHGWAGAAG-EAGIDTVGFADSNDPALFAGH 236
gi 502921018 165 IVT-DGRLARHSHHPFAMRAILADLAD-----------RGEAWPQLVIADHGFAGAAG-EAGVPAMGFADCNDPALFLAE 231
gi 270505282 173 MLA-DRGTFVHTHDPAPMRAMIDELGD--------------DRPDLVIADHGWAGAAG-EAGILTVGFADSNDPALFVGE 236
gi 504846665 158 VFE-RGASLWHTHSPEPMNAILDGLGE-----------DGR--PDLVIADHGWAGRAG-QRGIDSVGYADCNDPALFIGE 222
                        250       260       270
                 ....*....|....*....|....*....|....
gi 81717783  228 SEGTVQVTVPLDDHVKsPRHYDPMTAYLLSGAGL 261
gi 123628747 232 HEGKLHVTVPLDDGYV-PDEYRPLSDYVIYRAGL 264
gi 503908614 228 AEGTLAVTVPLDDHVP-PHHYEPMTAYLLNAAGL 260
gi 502617876 246 VEGRILVTVPMDDGVH-PACYEPLTAYLMSHAGL 278
gi 501366167 227 AQGQVEVVVPLDDNVA-PHLYDPLVDYIISRAGL 259
gi 503162933 225 EQGDLPVCVPMDDNVP-PNRYEPLIDFLVNHASL 257
gi 407304908 237 AEGKIAVTVPLDDGVF-PEYYEPLTTYLLDRAGL 269
gi 502921018 232 AEGKLLVTVPLDDGYL-TEDYAPLREYVLARAGL 264
gi 270505282 237 AEGKIAVTVPLDDNVL-PRYYDPLTRHLVERVVR 269
gi 504846665 223 AEGTMQVTIPLDDHVLdPRFYEPLTAYTLNAAGL 256
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap