Conserved Protein Domain Family
DUF4667

?
pfam15700: DUF4667 
Domain of unknown function (DUF4667)
This family of proteins is found in fungi. Proteins in this family are typically between 172 and 313 amino acids in length.
Statistics
?
PSSM-Id: 318002
View PSSM: pfam15700
Aligned: 17 rows
Threshold Bit Score: 50.8104
Threshold Setting Gi: 367004246
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74695751    3 DSQNTPVNAQITLCAVADSRpeqwagadir-------------------------------------------------- 32
gi 74591910   20 SSKNVPLNAFLIYTMSSTLPdhnstnswneyhnnlsitnntqvttscadn------------------------------ 69
gi 74586881   19 DSCNNPLNAFLIYSGKTDTHsnnnngaddemattdesmsplasstflspmtppgsrnttqlsnqqltkp----------- 87
gi 1730663     9 CAVNIPVSAHITFHYKSIADrsssrsssssscssatskacsprgssvglppalstdneivet------------------ 70
gi 401623813   9 CAFNTPVSAHITFHYKSTADrsrsrsrsssgsccsssttsngcsprgssaglppalsseneiietvl------------- 75
gi 367004246   1 MGLNRPISAQLMIYNTNSNSddeglvgsrselenraaasshstlqsessshsgacfs----------------------- 57
gi 156848919   3 YTLNRPLSGHLTICTTQNCQfsdyynkddttnn----------------------------------------------- 35
gi 410080472  38 SSMNKPLSAQVIFLYKQLSSsreslqg----------------------------------------------------- 64
gi 366993228   9 AAANRPLSAHLTIHYQNTDKkspstsasrdnmapsldsqysisknytaekkerstsrevirtilnigtadtlddefvlan 88
gi 255710871   3 SSENRPVDAHLVVRYAVAEDngetgagsaegaawehgsrrgsvqgts--------------------------------- 49
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74695751   33 ---------------------------------------awalqrplsnSQKIC---D----------LYQCVHCGevaa 60
gi 74591910   70 --------------------vkttsnvprcatdinskmttsemetlhrcRFSVC---D----------FNNLENYL---- 112
gi 74586881   88 -lrchrrpsmikctslpeltamsthtvttspplsslitnstthailgnrRISIC---D----------LDNFTGEIdyvk 153
gi 1730663    71 -------vlnvsapvvadptrpslfksnytaascltsdptspsllpssrRNSVLpasD----------FHQCAHHKnfqr 133
gi 401623813  76 ---svsapvaeedeeeeeptpsslfknnytaascltsesvspsalpssrRNSVLpasD----------FHQCAHHKnfer 142
gi 367004246  58 -------------ckyggdprhsqlprrvvsssvpissagtsmklngsrQRSIC---D----------LFQCEHKShscr 111
gi 156848919  36 -------------------------------------dnkhtfitltdsNNNQT---K----------FVQCRKSIsnes 65
gi 410080472  65 ------------------------------------------nkeivhtVINVM---DshtdesevsmLYNAHdrfsdss 99
gi 366993228  89 snsnsnsslnmlesielpssssrrpsvatpcpfllltsdkdktvtrlstYMNIY---D----------LYQCVPQSngnh 155
gi 255710871  50 -----------------------icvvepwrgpgqgstpeaaptrrlsaSMRVS---D----------LYQCVHSretsm 93
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74695751   61 rrakrrsarrasethaegpwdepaarslhi--------------------------------------tvsyeevewrlr 102
gi 74591910      --------------------------------------------------------------------------------
gi 74586881  154 qqqheqhqqqlqspdianfmycnlstsd------------------------------------------idktprkfsf 191
gi 1730663   134 rasepqlps----------------------------------------------------------------------- 142
gi 401623813 143 rasepqlps----------------------------------------------------------------------- 151
gi 367004246 112 snssgnrhsassshietagargrrrsdshltikndnn-----------------------ssffnnfllhdlvtedsgat 168
gi 156848919  66 sptsrfsdtdlssii----------------------------------------------------------------- 80
gi 410080472 100 ilesssyltted-------------------------------------------------------------------- 111
gi 366993228 156 hslkhinnhkntqfiarrfsdpqlqtitkdslptslsfttakttslknpysmeatprsyrtndpilhvntstgttdtttn 235
gi 255710871  94 sgpgalwgaggeevspgtspgtsprts-------------------------------------------vaqqgaggve 130
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74695751  103 rrtlpilpsaqdargargaapLFQASVDEDDAGSCEESESAPG----------SAGARAGDDVVLTSPCSRHHHRRNSIA 172
gi 74591910  113 ---------------------YQSEREECSRVIEQLETHNGKSi---------STCCNSNTDINAQCNQMKNHKRRKSIA 162
gi 74586881  192 hhrpktapgmmiggsdetpqnHDHEDNEHEYGPKQQEQESMEIdkekeevatqNTQLPHHYIENLASFQFRNHKRRNSTA 271
gi 1730663   143 ---------fdnrsssemkrsVSYAQHSMMFPISDQQEPQTSA--------------SPNDHSDPSCPCNRHHHRRNSVA 199
gi 401623813 152 ---------fsersssgmkrsISCAHHSMIFPISDLPESLAPA--------------SPTGHSDPSCPCNRHHHRRNSVA 208
gi 367004246 169 ernyscfpspttnpgpatlsrKDSFGKGSSETEDDEEENGEVT-----------------ISFLNESPCTRHHHRRNSTA 231
gi 156848919  81 --mnhngklryhlrgsdscddDDDDDDDEDIDIDKNNNPKISRiss-----lpNYTFTKHSIAGSPCPCPRHHHRRNSTA 153
gi 410080472 112 --yyegyshflenkrivgdssRNCSRSNSVQSCLNTTNDGITD----------------------SSPCDKHHHRRNSVA 167
gi 366993228 236 ngipsspppflsasasslsgsNSSFTTTTNTSSQQQQHNNNHN---------------MNPFIDISSPCSRHHHRRNSIA 300
gi 255710871 131 trvptaaaapppsrnssllssSSQQSPRSRTGSQDSEALGACPghe-----caSHDAHGDCWIDASTPCDRHHHRRKSTA 205

                 ....*....
gi 74695751  173 VRFTKTCLK 181
gi 74591910  163 LKFKKPQTL 171
gi 74586881  272 LKFEEPKIL 280
gi 1730663   200 VKFDKPLYE 208
gi 401623813 209 VKFNKPLYK 217
gi 367004246 232 LKFEKPYYI 240
gi 156848919 154 VKFDKPSYK 162
gi 410080472 168 VKFNKPDYK 176
gi 366993228 301 LKFEKPLYK 309
gi 255710871 206 IKFRKALYE 214
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap