Conserved Protein Domain Family
HPS6

?
pfam15702: HPS6 
Hermansky-Pudlak syndrome 6 protein
Statistics
?
PSSM-Id: 318003
View PSSM: pfam15702
Aligned: 12 rows
Threshold Bit Score: 1006.11
Threshold Setting Gi: 821452611
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 557024289    1 MKE-FVLEKLSDFSDFARHKSLVEILR--------RWQAGSGVLASPDGRHLLLLTggSQEmkeqqlstfdrIW--SC-- 67
gi 597771526    1 MTR-HALEQVTDFGDFTRGKELKEVLKqsfnssspSQNCLSNVRVSPDGRHIHVIQ--QTPks--------gLM--TCdk 67
gi 637328957    3 qartLLLRQILDWDDFIHSRALRELL---------LDQLPNRVLASPDGQHLLLLC--Rsrvv-----afqrLGteGGgd 66
gi 972972703    1 MKH-LALDQLADLGEFTGGGDLTEYLKqsnm-kscNWSALRDIRISPDGQHIHVIL--HKPkg--------gLM--TFdr 66
gi 1043415320   2 MKF-GPPQLECDFQAFGRQHVLREAL----------HTPGSRLYHSPDGRHLFVLL---PHkvlsflrlpsqAPlsPSay 67
gi 125991924    1 MKRaGTLRLLSDLSTFSGAARLRELL---------AGDPAVRVRCSPDGRHLLLL---RPPgspapqllvavRG--PGee 66
gi 555951882    1 MKRaGTLRLLSDLSTFSGAARLRELL---------AGDPAVRVRCSPDGRHLLLL---RPPgspapqllvavRG--PGee 66
gi 821452611    1 MKRaSTLRLLSDLSDFSNANQLRQVL---------AEEPLARGRSSPDGRHLLLL---RPPgspaplllvsrKG--AGlg 66
gi 542199926    1 MAG-LVLKQLSDFGDFSHGKELTEILSl------nNNEQINSVRMSPDGRHIHVVL--RKPkvslvt----------fdk 61
gi 551497896    1 MSR-FVLEELSDFRDYAGSQKLSDLLTfsk--depSRIKLSDVRVSPDGRHVHVLL--RQPkvglmt----------fdk 65
gi 768916442    1 MAR-LFLEKISDFGDYTGGQELTEFFQvts---ddLKDTLSCVRLSPEGRHVHVIQ--SKPkvglvt----------fdk 64
gi 971403062    1 MKPaGTLRQLSDFSDLSRGRRLRELLR--------HGEEPRSVRPSPDGRHLVVLQenRPPplpprvvafqrQGg-GGae 71
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 557024289   68 --SPPAPLQP-----------PgyldksfsrigLAGLFFLEs--rRGAAPaPATAVGIVLENGRTEFWR--YAPCQARWE 130
gi 597771526   68 yqRAHLVQCQkqldlvltrnlP-----------IVDVIYFAh---SSADD-GSTVLGVIFENGKVEFWR--FSERKSGWN 130
gi 637328957   67 leRSWHPPQP-----------P-----------VVGLFFLE----SPSAA-IPWVLGVVWERGKAELWR--FVP-STGWH 116
gi 972972703   67 lqRTHQLQNH-----------KhldlgsgtsgkIVDLVYLGq---rDKDG-GSSDLAVVQENGGVEFWR--YEECKAGWY 129
gi 1043415320  68 leKSWAAHSP-----------P-----------LSALLFPQc------vP-HGWALTLLWQNGRTEIWSppRSALSKGWE 118
gi 125991924   67 leSAWPPGQP-----------S-----------PLDAFLLP-------WR-ARSALVLVWESGLLEVWG---SGVGPGWR 113
gi 555951882   67 leSAWPPGQP-----------S-----------PLDAFLLP-------WR-ARSALVLVWESGLLEVWG---SGVGPGWR 113
gi 821452611   67 lePRCPAGQG-----------P-----------VLDAFFLQc--pGWASG-PCPVLALVWASGRAEVWG---AGVQPEWQ 118
gi 542199926   62 yeRPQLAPNQkkldl--cvnvP-----------IVDIFYLEh--hGGSSS-GAAVVAVVYESGKVEFWK--FQECKSGWH 123
gi 551497896   66 heRPQLALNPkkldvwfkggvS-----------IVDVFYLDllhnKGKGT-GVVAV-VVYENGKAEFWK--FLDYKTGWY 130
gi 768916442   65 ceRPLLLQNQkkldlvskrtvP-----------VVDVLYLGd--gGGGGR-DAPAVAVVYEDGKAEFWK--HLPCKNGWH 128
gi 971403062   72 leRSWQPPQP-----------A-----------LAGLVFPQ----SPAAP-GRWALGIVWEHGRTELWR--FVP-AAGWQ 121
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 557024289  131 LAQTANLCNSPRARVVSVCSQGQLIVWCEERPPSE---SS--LTPAKSAFSYCICKRTFEL-REPGVELGSVQIVLHNSP 204
gi 597771526  131 LFHSADLCNSPRAKIVSVCLCQNFIIWCEERPPSElqsSSv-SSVPRNNFRFCICKRTFEV-DEGGVSLGGVKIALHNNP 208
gi 637328957  117 MLQSLELCHGGRARIISVCSWRGQLVWCEERPALG----Al-MTPERRAFQYCICTRSLQI-GEQGAQLSPLRVILHNSP 190
gi 972972703  130 LQQTSELCNSPRAKVVSVCASGNVIIWSEERPPSE---SSlsSTAARNNFQYCICTRTYEL-EERGVCLGGVNIMLHNSP 205
gi 1043415320 119 LLQSLDLCNSPRARLASVCSNGESLVWCEERPPSEa--KLq-GPSGAKAYRHCICHRRLVWeGEQQVTLGSMNILLHHSP 195
gi 125991924  114 LLQSTELCPGGGARVVAAAAPRGRLVWCEERPAGT---EGq-LGPPAVAFSHCVCVRTLEPsGEAGTNLGSTHILLHHCP 189
gi 555951882  114 LLQSTELCPGGGARVVAAAAPRGRLVWCEERPAGTe---Gq-LGPPAVAFSHCVCVRTLEPsGEAGTNLGSTHILLHHCP 189
gi 821452611  119 LLQQVELCVSSKARVVSAAALGNRLAWCEERPASTe---Vt-PGSAQAAFGHCVCTRALEPhGENSAMLGAPRILLHHCP 194
gi 542199926  124 LLQTSQLCNSPRARVVSVCACSNLIIWCEERPPSEs--sPv-PSATRNKLRYCVCRRDFEV-KETAVNLGGVKIALHNNP 199
gi 551497896  131 LLQTSDLCNSPRARVLSVCVCSSLLVWCEERPASEn--sSa-LSSTRNKLRYCICRRDCEV-EDGAVNLGGLKIILHNNP 206
gi 768916442  129 LLQTSDLCISPRARIVSACASSNLLVWCEERPPSEs--sPa-LSSSRNHLRYCVCRRDFEV-DDGTVTLRGVKIILHNNP 204
gi 971403062  122 LLQTLELCQGARARVVSVCSQAASLVWCEERPPLD----Ah-SDASKCAFRFCVCARALEL-GEQGVRPGPVRIVLHNCP 195
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 557024289  205 SYQVLSAADGVFLWP--SDASLGSVSKCLLIWTPWDDRVTITAPAKGYVKTKNLNPL-ES--DFKRFVLDCVGFLS-SVE 278
gi 597771526  209 CYLVVSSGDLVYLLPdtNEHPIIPVSKVFLAWSPQHDIFKVHSVSSGTLLIRNSTANkES--DFKRLVTDCIGILSlNIT 286
gi 637328957  191 LYQVLASPSGVFLVP--TPDTFTNIAKFIIIWQPENATISVAAPSRGCICTKASHPGsEV--DFKKLVLGYVSFLA-SMD 265
gi 972972703  206 RYAVIASADNVYLLPdnNETKLSSISKFFLTWSPDPDSITVSSACKGTLLRKDLHLSkES--DFKRLISDCVGLLS-TIN 282
gi 1043415320 196 FFHLLSSPNHIFMVP--DGNLRTNGARLLLVYSPQDERINMATITKGLIHSKSISEC-ES--DFKKLVLECLGYMA-SQI 269
gi 125991924  190 AFGLLTSRKDLFLVP--TATTWPGLGHILLIWSPSKGKVVVAAPCLGLSHSKSLNPGrGDtwDFRTLLRGLPGLLS-PRQ 266
gi 555951882  190 AFGLLTSRKDLFLVP--TATTWPGLGHILLIWSPSKGKVVVAAPCLGLSHSKSLNPGrGDtwDFRTLLRGLPGLLS-PRQ 266
gi 821452611  195 HFQLLASRSNFFMVP--TATTWPNVAHILLIWYPAKGRITVTAPTHNLTYNKNLSSKgRDswDFRSLIRRVPGLLS-GGE 271
gi 542199926  200 DFTVVSSGEYVHLLPdlKSKPLLNISKFFLSWSPRYDSFTVSTTCKNTPLKK--LSAkES--DFMKLVIDCLGYLS-TLE 274
gi 551497896  207 KFTVISSGDYVHLLPdlKAKLQLCISKFFLTWSPHHDSFTISTTCKNTPIKK--LSAkES--DFRQLIADCLGYLS-ALE 281
gi 768916442  205 KFTVVSSGECVHFLPdiRARTLWSVSGFFLTWSPHRDSFAVGTLCKNTPLKR--LPAkES--DFQKLVMDCLGFLS-TLK 279
gi 971403062  196 EYRVLASPQHVFLLP--ASGAFATASNFLLVWHPEQAKLTIAAPSAGFVRSKALRSGsGS--DFRKLLLGSVGLLS-ALA 270
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 557024289  279 PCDAHHVGVSHCGGLLLVDRSNAIILIQSDGTKRHIYSFPDGSFGP-DSKMVVQIAGTTLVCVLGRILYLVNVSTGKLME 357
gi 597771526  287 PPDICGFCPTGAGDLLLLLSTGWVCTMQRDGVLRHIYKLPDNCLTTcGTQNSLKLYRDIIALTAGRMMYLIDAKCGLEMQ 366
gi 637328957  266 VLIIHGCALSSCGGLLLVTKAGMVELVQPNGTWRPVFDFGESAVAP-GQQVQLKAFGSTLACLLGGALHLVDLDSRQLIE 344
gi 972972703  283 PPEIIAFSATGCGGLLVLLGSGWISMLQKDGVLRRIYKLADNCLYDcSLCSSMHVYGGVLALTVDRTLYLIDIRCGTELE 362
gi 1043415320 270 PVGIRSFAVTGLGELLLMDALGGVHLLHPNGMVRCIYVFDSITLTP-EVRVSMQIYGATLVCAFDTVLYLIESNTGKLLE 348
gi 125991924  267 PLTVHTWAPTPQG-LMWLDFRGTVSLVQPHGGSRTVGTLQEAPASL-AGSAALGTFHGTLACVLGSTLELLDMGSGQLLE 344
gi 555951882  267 PLTVHTWAPTPQG-LMWLDFRGTVSLVQSHGGSRTVGTLQEAPASL-AGSAALGTFHGTLACVLGSTLELLDMGSGQLLE 344
gi 821452611  272 PLDIHTCAPSQES-LLLLSPKGVLSLIRRDGGTRAVGILGSGLLAQ-GVPVSLGVFNNTLACVLGSGLELLDMGSGRLLE 349
gi 542199926  275 PPEICSFSPTACGGLLLLLSTGWLCLLQKDGVLRQVYKLEDNCLVNySTHTSLGMYEDTLALLMGQNLHLIDLNCGRELE 354
gi 551497896  282 PPEICSFSPTGCGGLLLLLNTGWLYILQEDGMLRRMYKLADNFTPQaDTHTSLCFYVNIVALMVGKTLHLIEVNCGTELQ 361
gi 768916442  280 LPEIYNYAPSCHGGLLLLFNTGCVSLLQKDGTFRRLCTVADNRLMTcGTHTSLCLYEETLALIIGQSLHLIDVKCGRELE 359
gi 971403062  271 PLDVHTCAVSSCGALLLVSRKGAVTALEADGTQRHVFDLEAGPLAR-GDAVELKTYGSTLACVLAGVLYLVDQNSGRVIE 349
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 557024289  358 KMVLTTDVLTLLKP----H-----------NRNAIQILTKTGIYTAKPSASISgl-----gH--------------EVCN 403
gi 597771526  367 RITLKREGLLFVNC----L-----------ESHSPQMLSESGLFVVIQREVEAklkpsgahS--------------ENIN 417
gi 637328957  345 KKGLSTDGVLFLDFgtgvG-----------EEEEMQLLAPNGIYNLDLSNAAT------------------------ESQ 389
gi 972972703  363 KIPLKKEGVLFVNC----R-----------ERNVPHLLTESGLFVAKQRERDL--------Spktp-------ghsESIS 412
gi 1043415320 349 KKILSSDEVRLMNL----P-----------EVDDIHLMTKAGIYKVSSMSSVI-----------------------ETGK 390
gi 125991924  345 RKILSTDRVHLLEP----PapgmedqeeleTRGGLRLLSAVGLFQVGWKTPQS--------L--------------ELPS 398
gi 555951882  345 RKILSTDRVHLLEP----PapgmedqeeleTRGGLRLLSAVGLFQVGWKTPQSl----------------------ELPS 398
gi 821452611  350 RKVLSTDRVHLLEL----Sapgi---dedeNKSGLRLLSASGLFCVIWEVRKEg----------------------EWLN 400
gi 542199926  355 KIVLMSEALLYTNR----A-----------DMCTPHLLSETGLFVVVSRGTDS--------RdcsfrikspgfstvESIH 411
gi 551497896  362 KIALKREGLLYANQ----A-----------DRRTPFLLSETGLFMLTEKDSTG--------Ktlgl-------spaESNQ 411
gi 768916442  360 KIPIKREGLLYMNQ----A-----------KRCTPHLLFKNGLFNVVKKDCTS--------Kmkh--------sgsERFQ 408
gi 971403062  350 KKILSMKEVHFLES----Pg----------EEDSIQFLTPTGIYSFGFSNPED------------------------GGR 391
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 557024289  404 SEAVLGEMVFEEACKYYQRRSLNSTRLTVEKLKKGGMFQAPIALSSILQHY-----L---------------------Ar 457
gi 597771526  418 PSAILAEAVFEEACKYYQQRSLSTTQLTVEKLKKGGMFQAPISLAAIIRDY-----L---------------------Sn 471
gi 637328957  390 PEPNLVEMVFEEACKYYQRRSLSNSQLTVEKLKKGDMFQAPIALSAILCHS-----L---------------------Tp 443
gi 972972703  413 PESLLVEAVFEEACKYYQRRSLSSTQLTVEKLKSGGMFQAPIALSSILKGY-----L---------------------Kt 466
gi 1043415320 391 VEPVLLEMVYEEACKYYQRRSLSSAKLTVQELKKEGMFQAPIMLSSIFSNYhraekA---------------------Ks 449
gi 125991924  399 AE----DMVFEEACKYYQRRSLRGAQLTPEELRHNSIFRAPQALASILQGH-----V---------------------Sp 448
gi 555951882  399 AE----DMVFEEACKYYQRRSLRGAQLTPEELRHNSIFRAPQALASILQGH-----V---------------------Sp 448
gi 821452611  401 SE----DLVFEEACGYYQRRSLLGARLTTDDLRRGSTFRAPLALAAILQGH-----Q---------------------Pp 450
gi 542199926  412 PGALLVEAVFEEACKYYQQRSLSSTPLTVDSLKKGGRFQAPISLASILFSY-----LctgfkqkgaqlsqnggggciaG- 485
gi 551497896  412 AGAVLVEAVFEEACKYYQQRSLSSTQLTVESLKKGGRFQAPISLASILRNY-----L---------------------N- 464
gi 768916442  409 PGALLVEAVFEEACKYYQQRSLSSTQLTVDMLKKGGMFQAPITLASILRNY-----L---------------------St 462
gi 971403062  392 PEPCLVEMVFEEACRYYQRRSLSSSRLTVEKLKKGGAFQAPVALTAILQHS-----L---------------------Hq 445
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 557024289  458 ---------------------Rras--------------slQ------Q------------Eay------mKLLHVMDTD 478
gi 597771526  472 qk----------------mksA-------------------G------H------------E---------KLLSSLDSE 489
gi 637328957  444 ---------------------K-------------------D------K------------KpriltepyaKLLSTMQLE 465
gi 972972703  467 ---------------------Q-------------------K------TgerilggtsgtyT---------KLLSSLDAE 491
gi 1043415320 450 ---------------------K-------------------N------Y------------A---------DHVNTMTNE 462
gi 125991924  449 ---------------------S-------------------------------------------------ALLTTLRAE 458
gi 555951882  449 ---------------------S-------------------------------------------------ALLTTLRAE 458
gi 821452611  451 ---------------------T-------------------------------------------------KLLTDLQAE 460
gi 542199926  486 ------------------------------------------------Q------------D---------KLMGSLEAE 496
gi 551497896  465 ---------------------SglrrteteslqngggdyiaG------Q------------D---------KLMCSLEGE 496
gi 768916442  463 vakhkrtelsqdrdvelttgqA-------------------------------------------------KLMSSLEAE 493
gi 971403062  446 ---------------------K-------------------QkpagglQ------------Dty------aELLSAISME 467
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 557024289  479 LQSYSSLEQLKASVIQASEKEISRYCHDLVEQEITRLFHS-ELDRENLVYLNSVFSIFPRETWKAIKRTLQLQQNGEGFV 557
gi 597771526  490 LKSLVALEDIKTSMVKASEKNLANSCETLVHQEISRLLSS-EIDRENLQYLNSIFNLFPTETWQAVQTVLQLRCNGEGSL 568
gi 637328957  466 LQSYQNLELLKARVVGASESEVESYGEALVEQELSRLLHL-DSNKENLEYLNAIFSSFPKASWKAIQNHLQLQQNGDGIL 544
gi 972972703  492 LKSLVALEELKSSLVKASETELALHCENLVSEEVSRLLCT-ELDRENLLYLNVIFSTFPLESWQALQMVLQLRSYEEGSL 570
gi 1043415320 463 LQSCLSLEQLKAQIINIPEDVTEKYCENLIDQEIVRLLNT-DLDRENLIYINFLFSLFPKAAWKSVKGTLQFHQNGDGRF 541
gi 125991924  459 LRDYRGLEQLKAQLVAGDEEE--AGWTELAEHEVARLLRT-DLMGDQLAQLNTIFQALPTAAWGAILRVLQLQPDGNGHL 535
gi 555951882  459 LRDYRGLEQLKAQLVAGDEEE--AGWTELAEHEVARLLRT-DLMGDQLAQLNTIFQALPTAAWGAILRVLQLQPDGNGHL 535
gi 821452611  461 LRDYHGLDRLKTRLVAADGQE--EGWAELAEREVERLLRS-DLTGDKLSQLNAIFSAFPAAAWCSTRRALQLQLDEAGQL 537
gi 542199926  497 LKALVSLEEVKGTLVRGSVKEVEAVCESLVEKEVLRLLSSpELDKEALLYLNSIFSIFPSEGWKAAHSALQLHYNGEGFL 576
gi 551497896  497 LRALVALLELKGSLVRGGVKEVEAVGGTLVEKEVVRLLSSsELDGETLLYLNSIFSMFPGQAWSAAQAALQLHHNVEGSL 576
gi 768916442  494 LEALVSLEEVKSSLVKGGVKEVEALCESLVEKEVARLLSSsGLDKEALLYLNHIFSMFPCQVWKATQATLQLHYNGEGSL 573
gi 971403062  468 LQSYLSLELLKTCMVSASESEVESYCEELVEQEVSRVLHS-DMDKDNLAYLNSVFTSFPRAAWKATRSCLQLQQNGDGLL 546
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 557024289  558 SARATPDVWKTVL----------------------------------HQ------------------------------- 572
gi 597771526  569 SSKAPAELWKIVL----------------------------------CP------------------------------- 583
gi 637328957  545 AARATPDIWKKIL----------------------------------WG------------------------------- 559
gi 972972703  571 SAKAAPEVWKTVL----------------------------------SP------------------------------- 585
gi 1043415320 542 IVRATVDLWKRIL----------------------------------GP------------------------------- 556
gi 125991924  536 RSQAPPDVWKKVL----------------------------------GV------------------------------- 550
gi 555951882  536 RSQAPPDVWKKVL----------------------------------GV------------------------------- 550
gi 821452611  538 KSRAPPDLWKKVL----------------------------------VD------------------------------- 552
gi 542199926  577 SSRAPPDVWKTVL----------------------------------SAglssspvaslsltnggpkhnyslkvdyftnc 622
gi 551497896  577 SSRAAPDVWKMVL----------------------------------TP------------------------------- 591
gi 768916442  574 SSRAPPDVWKTILgpavtpstttsvpvsngrpeharrnksetvangaAK------------------------------- 622
gi 971403062  547 VARATPEIWKKVL----------------------------------GG------------------------------- 561
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 557024289  573 -GTVSYQd---tT-------MN---------------------G-----------AIPVFELICHSLYRFKPKWLPRFVE 609
gi 597771526  584 -VQTTANf---tH-------CN---------------------GqqlqmhapanvAVPVFELLCHTIFKFQPSWLPRFLE 631
gi 637328957  560 -PLSSLSkqeegT-------LN---------------------G-----------VLLLFELICLALHQFKPKWLPQFVE 599
gi 972972703  586 -VPAGHAt---pPngqqcppAN---------------------G-----------AVPVFELICQSLFRFQPRWLPRFVE 629
gi 1043415320 557 -LSAGSRe---sS-------QN---------------------G-----------VSPLFEVICESLYRFKPKWLPLFVQ 593
gi 125991924  551 -TAAGKE-----P-------PN---------------------G-----------ILPPFELLCQCLCRLEPQWLPPFVE 585
gi 555951882  551 -TAAGKE-----P-------PN---------------------G-----------ILPPFELLCQCLCRLEPQWLPPFVE 585
gi 821452611  553 -A----------G-------TD---------------------G-----------ALPAFELLCQCLCRLEPCWLPPFVE 582
gi 542199926  623 kAKSTSS-----T-------SS---------------------A-----------ALPVFELLCRSVFHFQPSWLPRFLE 658
gi 551497896  592 -CPNSLP-----A-------MNgqskhspslkgdnnckvttspA-----------ALPVFELLCQSVVRFQPGWLPRFLQ 647
gi 768916442  623 -ATAA-------S-------PP---------------------A-----------VLPVFELLCRSVFHFQPGWLPGFLE 655
gi 971403062  562 -PQQEEV-----G-------QN---------------------G-----------AVPLFELICASFLKFKPKWLPSFVE 596
                         890       900       910       920       930       940       950       960
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 557024289  610 LTQQHV------------------S--GT--------------W--N----YGG-----------------KENPE-N-V 630
gi 597771526  632 LAQQQS------------------V--SS--------------T--TsswsFGV-----------------KESSE-S-L 656
gi 637328957  600 LSQEYM------------------G--AT--------------W--T----YSS-----------------KEGPE-GsV 621
gi 972972703  630 LAQQQQ------------------AgiSS--------------W--N----YGA-----------------KDSPD-S-P 652
gi 1043415320 594 QAQDCS------------------G--LP--------------W--S----MSN-----------------KDNCE-G-V 614
gi 125991924  586 L----A------------------Q--QQ--------------G--G----PGW-----------------GAGGP-G-L 602
gi 555951882  586 LAQQQG------------------G--PG--------------W--G----AGG-----------------P-----G-L 602
gi 821452611  583 LAQQQG------------------G--PG--------------WglG----AGG-----------------P-----G-P 601
gi 542199926  659 LAQKEQ------------------G--STglglglaasswsfsG--G----RGG-----------------DCNES-N-V 693
gi 551497896  648 LSQQQQgsaalglslassswgfpsG--------------------------RGG-----------------ESGEN-N-V 682
gi 768916442  656 LAQQQR------------------G---------------------S----AGLglslassawsfprgrggDAGDG-N-A 690
gi 971403062  597 LTQQYQ------------------S--IS--------------W--P----YSS-----------------KEGLEgR-V 618
                         970       980       990      1000      1010      1020      1030      1040
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 557024289  631 PLYKRAMSVLQakdvaANADDttELEIELLLCSERPKAILQAIRTLIFHKKWERVVAAAQQYSQKSPLLNKEIFTILLEE 710
gi 597771526  657 PLYKRALAVLPc----KGAYQ--DLEVELLLCSQRPNAVMQALRILMGLGQWDRVTQVAQRFCCQSPLLNKEIFTTLLCE 730
gi 637328957  622 PLYKRALAVLPrrhkcSVADR--DMEIELLLSSQRPKAILQAIGQLIRHQRWQRVMEAAEKFSRLSPLLNKEIFIILLGE 699
gi 972972703  653 PLYKRALAILPe----KAEYQ--EVEVELLLCSQRPNAVMQALRLLMQLGKWGQVAQVAERFCQQSPLLNKEIFTTLLGE 726
gi 1043415320 615 PLYKRALAVVSkgkanTTANGdcDIEIDILLYSGRPQAIIQAIHMLIDLQRWERVITETQKFSQLSPIITKDIFITLLTE 694
gi 125991924  603 PLYRRALAVLGeegtrPEA-----LELDLLLGSGRPKAVLQAVGQLVQKEQWERALEAGLALSPSSPLLRSEIFKLLLAE 677
gi 555951882  603 PLYRRALAVLGe-----EGTRpeALELDLLLGSGRPKAVLQAVGQLVQKEQWERALEAGLALSPSSPLLRSEIFKLLLAE 677
gi 821452611  602 PLYRRALAVLGd----WAGARaeALELELLLGSGRPKAVLQAIGQLVQAGQWERILDAGLAFSPSSPLLQMEIFTVLLAE 677
gi 542199926  694 PLYKRALYLLSslnpdRDQQQ--DLEVELLLVSGRPNAILQALRILMSKKQWYRVTQVAQKCCKQSPLLNKEIFTILLCE 771
gi 551497896  683 PLYRRALWVLSsldtdTEQRQ--DLEVELLLVSGRPNAILQALRILMVKRQWERVTQVAQQFCKQSPLLNKEIFNSLLCE 760
gi 768916442  691 PLYKRALRVVSgltrdRDQQQ--ELEVELLLVSGRPNAVLQALRILMAQQQWERVIQVAQEFCTKSPLLNKEIFTTLLCE 768
gi 971403062  619 PLYKRALGVLArkskhNEVDD--ELELELLLCSKRPKAVLQALHLLIRLKQWQRVVEVAEKFSKLSPLLNKEIFTTLLAE 696
                        1050      1060      1070      1080      1090      1100      1110      1120
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 557024289  711 FSQHRNLDPYLKQLWALCPEDITVTDILN----------------------VVLKHVP--------------KSEQD-TG 753
gi 597771526  731 VSQHRHLDPYLDLLWALCPEDMTVTGILN----------------------IVLKNLP--------------SSGQScTG 774
gi 637328957  700 FSKHRALDPYSDMLWELCPADLSASDLLS----------------------VIQQHLS--------------PADCD-PS 742
gi 972972703  727 LSQHRDLDPYLDLLWTLCPEDLTVTSILN----------------------IVLKNLP--------------PSTPE-RG 769
gi 1043415320 695 FVRHRHLDSYITQLCDICPEDMTPTDMLR----------------------IILQNMP--------------DEQ---HL 735
gi 125991924  678 FARHRRLDAHLPLLCRLCPPDLAPAELLL----------------------LLRTYLP--------------DELEP-PA 720
gi 555951882  678 FARHRRLDAHLPLLCRLCPPDLAPAELLL----------------------LLRTYLP--------------DELEP-PA 720
gi 821452611  678 FARHRQLDAHITRLRRLCPPDLTPTDLLL----------------------LLKKHLP--------------DEEGP-PA 720
gi 542199926  772 VAHHRDLDPYLDLLWTLCPEDFTVTTILN----------------------LVLKNLPspntpshsssflasSSTSStPP 829
gi 551497896  761 VSQHRELDPYLDLLWALCPEDYTVTTILN----------------------LVLKNI---------------SCSPPsPA 803
gi 768916442  769 VTQHRDLDPYLDLLWALCPDDLTVTTILNlvlnnlsspnsspsslssssvcFL-------------------STSSSrPA 829
gi 971403062  697 FAQHRELDPYLDTLWPLCPAELSTSDILT----------------------VVLQHLP--------------CSQQD-AV 739
                        1130      1140      1150      1160
                  ....*....|....*....|....*....|....*....|....
gi 557024289  754 PYSK--D-GSLLTVGLLKPLLSKVLQRECRANE---EYSCVLQA 791
gi 597771526  775 PFQGsqH-SSQLTIGLLKPLLTKVLQRETKPSQ---RYADILQS 814
gi 637328957  743 PFPPe-G-SSQLTVGLLKPLLHKLTPSPSGRAE---MYADALQG 781
gi 972972703  770 PFQT--D-GSHLTVGLLKPLLSKVLQRETKPSQ---RYADILQs 807
gi 1043415320 736 PFSCn-G-GTQLTVGLLRPLLNKVIQNQKAQHM---KPTALTFS 774
gi 125991924  721 PFPEp-GaEPPLTVGLLRALLKQTGTQGRASGPvlsLYEDILWd 763
gi 555951882  721 PFPEpgA-EPPLTVGLLRALLKQTGTQGRASGPvlsLYEDILWD 763
gi 821452611  721 PFPKmgA-DPPLTVGLLRDLLEQARSEAQVPSP----YEDILWD 759
gi 542199926  830 PFTDp-H-STQLTIGLLKPLLRKVLQRETKPSQ---RYVDILQS 868
gi 551497896  804 PFADp-P-SSQLAMGQLKPLLRKVLQRETKPSQ---RYADILQS 842
gi 768916442  830 PFVDp-Q-SSQLTIGLLKPLLRKVLQREAKPSQ---HYADILQS 868
gi 971403062  740 PFSS--K-GNQLTVGLLKPLLQRVMQRPCVQDE---MYSDALQS 777
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap