Conserved Protein Domain Family
Mt_ATP_synt

?
pfam15704: Mt_ATP_synt 
Mitochondrial ATP synthase subunit
This plant mitochondrial ATP synthase subunit may the the equivalent of the mitochondrial ATP synthase d subunit.
Statistics
?
PSSM-Id: 318005
View PSSM: pfam15704
Aligned: 9 rows
Threshold Bit Score: 154.923
Threshold Setting Gi: 552823277
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 565386445  38 AAPTTLKGD-QVLKDIFYEVKNKLETAIGVLRKEKITIEPEDPAAVSEYAKVMKSVRQKANLLSESEIIKFNIEVETHEI 116
gi 302755820  32 AEQAEEEPK-DIVKEKFIEKLELLFNLTREFRKFRIVIDPDDPKVVKELSDNILQARSNVGLPPPEVQLQNMMEGLAQRS 110
gi 168008180  35 gkpaaeaGD-DVVKAVFQRQQKNFRAYLDEISKSKLDLDANSEAAVKAYFDTQVKIRTGLGIPSYTQKISELLEGAAEEA 113
gi 552823277  34 ATPAQPAQDeDIVLSSFRQSQQQYQQLMQGLQNISLPLT-GDDAAIKKYAADVEALKKQIGMPDVEDVISAELDYKFACT 112
gi 225438529  37 APP-ALKGD-EMLKNIFLEVKKKFETAMGVLRKEKITIDPEDPAAVNQYAKVMKTVREKADLFSESQRIQYTIQTRTQGI 114
gi 695031356  40 NLP-PLKGD-EMLKSIFYEVKNKFDIALGVLRKEKITIDPDDAAAVSQYAKVIKTIREKANLLSESQRIKYTIEQHTQGI 117
gi 242063932  37 DRP-PVSGD-DLLKGIFFEVKKKFETALGVLKKEKITIDPEDPAAVSRYAQVMKTVREKADLLSDSQRIKYTIETFTKGI 114
gi 145352451  21 GKPKASGETtDVVKRVFIEQQTKFRALLTKTKDLKPPVG-GDAAAVKAYAAKKLAALKELDISTPGEKILETVDGAFAEA 99
gi 30681554   37 ARP-TFKGD-EMLKGVFFDIKNKFQAAVDILRKEKITLDPEDPAAVKQYANVMKTIRQKADMFSESQRIKHDIDTETQDI 114
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 565386445 117 P-DARTYLLKLKEMRVKRGLIDSQGIEDlQMAALDKVEKELKKPLLRNDKKGIALLTAEFDKINQKLGIRK---EELPKY 192
gi 302755820 111 K-SVRQFYEKLGRFQASKGMEDVEGNKA-MMEVIDAVESKIGKPLTRDDKEGMRLFEEQSAAALKRLDTDP---EKFDEY 185
gi 168008180 114 P-DVRTFLNIHSSLRREVGIEDDSGADAlMLEALDKVEKSIGKTLVKDDANGMSAWKKELDQVNQKLGIDD---AMLEKL 189
gi 552823277 113 GyAVRQFVTEALESMSLGG--SMAAAKAeIMAALDEAEKAGGGELDSANEKGWQVLTAKLGEIEKKYGL-----ADKGKV 185
gi 225438529 115 P-DARTYLLTLKEIRIKRGLTDELGAEAmMMDALEKVEKELKKPLMRNDKKGMALLMAEFDKVNKKLGVRK---EDLPKY 190
gi 695031356 118 P-DARTYLLTLQEIRIKNCLTDDLGAEAmMMEALEKVEKEIKKPLLRSDKKNMALLLTEFDKINKKLGIKK---EDLPKY 193
gi 242063932 115 P-DARTYLNTLQQIRIKSGLIDHLGIEPlMMEALEKIEKDIKKPLLRSDKKNMATLLAEFDKINKKLGIRK---EDLPKI 190
gi 145352451 100 A-SVRGFLEYAGELRQMLGLKDEDDTMKvMVSALDETEKALGKALLTSDAQGMAKYSSAVAKASEAAGIKPldaAAMAKL 178
gi 30681554  115 P-DARAYLLKLQEIRTRRGLTDELGAEAmMFEALEKVEKDIKKPLLRSDKKGMDLLVAEFEKGNKKLGIRK---EDLPKY 190
                        170       180
                 ....*....|....*....|....*....
gi 565386445 193 EEQLELKIAKAQLEELKKDALEAMETQKK 221
gi 302755820 186 MEQRNLDKAKLLLLTMKKGASETIDRFMK 214
gi 168008180 190 EEEAEYAAAKAELEELRNTAMDRIDTYKR 218
gi 552823277 186 REEAIFEMYKQHINQLRTTVLSDMNkart 214
gi 225438529 191 EEQLELKIAKAQLEELKKDALEAMETQKK 219
gi 695031356 194 EEQLELKIAKEDLQGLKEEVTEAMESHLK 222
gi 242063932 191 EEELELEIAKSELSELKKECVEAMETQLK 219
gi 145352451 179 QGEVDLESIENEILEL-----QSVEDEVK 202
gi 30681554  191 EENLELSMAKAQLDELKSDAVEAMESQKK 219
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap