Conserved Protein Domain Family
DUF4670

?
pfam15709: DUF4670 
Domain of unknown function (DUF4670)
This family of proteins is found in eukaryotes. Proteins in this family are typically between 373 and 763 amino acids in length.
Statistics
?
PSSM-Id: 318010
View PSSM: pfam15709
Aligned: 6 rows
Threshold Bit Score: 576.565
Threshold Setting Gi: 1040226586
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 727863577   585 NETSPLTQKPENQGAQQSLEAAAQKTGEPQSCINKGLICSNRKEFYTRKLHLDMTPFLKaSREEMDDHeEGGE-LRENHP 663
gi 1040226586  467 FETSPLTQTTEEQGAQQSLEAAAQKTGEPQSCTNKGPICSNRKEFSTRMLHIDMTPFLK-GGDALDSSeEPGGpLGGADQ 545
gi 431895053   397 NETSPLTQRPEKQGAQQSLEAAAQKTGEPQSCINKELICSNRKEFYTRKLHIDMMPFLKeSGNELDYH-EPGGpLGENHR 475
gi 675665119   635 YETSPLTQTTEKQGAQQSLEAAAQKTGEPQSCINKGLICSNRKEFYTRKLHIDMTPFLKeSREALDYQeEAGRsLRETHH 714
gi 355750757    34 YETSPLTQTTEKQGAQQSLEAAAQKTEEPQSCINKGLICSNRKEFYTRKLHIDMTPFLKeSGNALDSQeEAGRpLRETHH 113
gi 831217518   653 HETSRLTQTTEKQGAQQSLEAAAQKTGEPQSCINKKLICSNGKEFYPRKLHIDMTPFLKdSEDALDYHeEPEEsPRESHQ 732
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 727863577   664 DAQd-pVRRNMTLDPLCASLAKHMQTPEADTVQKA-SKDynvHHRHRGLSGHGPDSPEGLDPIDTSFlprgkegktePRL 741
gi 1040226586  546 DGQ---EPGMATLVPLSTSLPECIQTPEADSVKETdGEH---SAPPRGLPRHRPDSPESPAAVATSL----------PGW 609
gi 431895053   476 DTQd-qEPRSVTLGPLSATPADHIRTPEADAVGKV-GKDynvHHLHRGLPGCEPESPERLSPIDTSLlpkeregktePRL 553
gi 675665119   715 DDQd-pEPRSMTLDSLSASQTEHIQTPDADTVQNV-GRDydvHHLHRGLLRHRPESPERLSAVYTSLlpreregkaePRL 792
gi 355750757   114 DGQgslEPRSLRLLEPAATCGENIMSLRLEVVKSCrGRDydiHHLHKGLLGYGPESPKKLSAVYTSLlpreregkaePRL 193
gi 831217518   733 DSQd-pEPRSVSISTLSAPLAEHIQTPEADTVQNG-GENydaHHLHREIPGHGPESPQKLGAVDTSVfpreregkaePSP 810
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 727863577   742 FNQKTSNNISN----------------------EMELIEKAKSRKRAKTDKS--------KAPKREKEGKLHEEAEAAVG 791
gi 1040226586  610 FSQRPPASLGHvnentdelhlkslpgthrghqeEEESIDKANRRKGTKTDKTkgtktdktKAPGREREGKVLGAAEAAGG 689
gi 431895053   554 FNQQTPVSISHe---------------------EMELIDKVKRKKKTKTDKS--------KMPEGEREGKAHVEAKAAVG 604
gi 675665119   793 FSQET-ASISH----------------------ERDLIDKAKRKKKPKTDKT--------KALKREREGKIYREAEAAVG 841
gi 355750757   194 FSRETSASISH----------------------ERDLIDKSKRKKRPKKDKT--------KGPKREREGKVYGEAEAAIG 243
gi 831217518   811 FGQQTSGSISH----------------------ERELNNKAKGRKRTKTDKI--------KAPKREQEGRVFREAEAAVG 860
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 727863577   792 KSKESKAEKKSQLISKGKKTGAKGKRTRKEGNLETa-AELSGPDGiNSKETKDRSGGGFFRSGSgVEDPWVSSKVEAPES 870
gi 1040226586  690 KSRHSKPERKAELISKAKRPVVKRNRPRKGRNREL--AELTGPDV-HSTRTEDASARGCFSADS-VEGPWLSHKDEFPET 765
gi 431895053   605 KARELKAKKKSELIPKGKKTGAKRKKTQKERNLEIa-AELDGPDViNSKETEDTSDRGFFPLGSvAEDPWLSPRYDAEES 683
gi 675665119   842 KSKDSXAKNNLE-----KKSGAQRKRTQKERNLEKa-AEQTGPDViHSEETEDTSNRGSFASDSfVEDPWLSPKYDAQET 915
gi 355750757   244 KSKDSKAKKKLE-----KKTRPQRKRTQKERNLETa-AELSGPDV-NSDETEDTSNRGSFASDSfVEDLWLSPKYDAQET 316
gi 831217518   861 KSKDSNTKQKLG-----KKTGAKRKRTQKARNLAIggAELSGPDViNSKETEDASDRGLFPSDSvVEDPWLSPKYDAQDS 935
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 727863577   871 QVSIDGRSSP--TQTAAVPGNMEPEEDRSHEDPSK---------------------AFLVKREQEKASRDRLRAERAEMR 927
gi 1040226586  766 QVSIDSRLSP--TQAVTAAGDLEPEEEESQEDPSK---------------------GLIPNREQEQASRDRLRAQRAEKR 822
gi 431895053   684 QVSIDGRSSP--TQIVPVTENMDSKEERSYEDPSK---------------------ALLAKREQENASRDRLRAERAEMR 740
gi 675665119   916 QVSLDGRSSP--SQIATVTGNMESKEERSCEDPSKvksdvlsltegvlsslgtsaeALLTKREQEKASQDRLRTERAEMR 993
gi 355750757   317 QVSLDGRSSP--SQIATVTGNMESKEERSCEDPSK---------------------ALLTKREQEKASWDRLRAEKAEMR 373
gi 831217518   936 QVVIDGKSSPsqTQTITVTGNTGSEEERSYDDPSK---------------------ALLFKREQ-KDSRDRLRAERAKMR 993
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 727863577   928 RLEVERKRREQEEQRRLQ------QEQLERAERMKEELELEQQRRVEEIRLRKQRLEEERQWQEEEERRQWLQLQMAQER 1001
gi 1040226586  823 LLEVERKRREQAEQRRRQ------QEELETAEQMKAELELEQQRRKEEMRLRKQRLEEEEQRRAEEERKQRLLMQAAQQR 896
gi 431895053   741 RLEVERKRREQEEQRRLW------QEQLERAEKMKEELELEQRSRAEEIRLRKQRREDERQRQEEEERKQWLQLQAAQER 814
gi 675665119   994 RLEVERKRREQEEQRQLQqeqlerAKKMEEELEQEQQRRAEEIR------LRKQRLQEEQQRQEEEERKQQLRLKAAQER 1067
gi 355750757   374 WLEVEKKRKEQEEQRQLQ------QEQLERAKKMEEELELEQQRRAEEIRLRKQRLQEEQQRQEEEERKQQLRLKAAQER 447
gi 831217518   994 QLEVERKRKEHEEQRRLK------QEQLERAKKMEEELELEQQRRTEENRLRKQRLEEEQQQQEEEERKQRLQRQAAQEK 1067
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 727863577  1002 ARQQQEEFRRKCQELQRKKQQEEAERAEAEKQRLKELEMQLAEEQKHLMEMAEEERLEYQRRKQEAEEKTRWEAEDRRQK 1081
gi 1040226586  897 ARLQQEEFRKKLRELQRKQQQEAAERAEAEKQRQKELEMQLAAEQKRLMEMAEEERLEYLRQKQEAAAKAQWEAEERRQQ 976
gi 431895053   815 ARQQQEEFRRKLQEIQRKKQQEEAERAEAEKQRQKELEIQLAEEHKRLMEMAEEERLEYKRQKQEAEEKARLEAEERRQK 894
gi 675665119  1068 ARQQQEEFRRKLQELQREKQQKEAERAEAEKQRQKELEMQLAEEQKRLMEMAEEERLEYQQQKQEAEEKAQLEAKERRQK 1147
gi 355750757   448 ARQQQEEFRRKLRELQRKKQQEEAERAEAEKQRQKELEMQLAEEQKRLMEMAEEERLEYQWRKQE-EEKAQLEAEERRQK 526
gi 831217518  1068 ARWQQEAFRRKLQELQRKKQQEEAKKAEAEKERQKELEMQLAEEQKRLMEMAEEERLEYQRQKQKAEEKAQLEAEERRLK 1147
                          570       580
                   ....*....|....*....|..
gi 727863577  1082 EKEAARLAQEEAMKQAQDQARQ 1103
gi 1040226586  977 EEEAARLALEEATQLAQEQARQ 998
gi 431895053   895 EEEAARLALEEAMKQTQELARQ 916
gi 675665119  1148 EEEAARLALEEATKQAQEKARq 1169
gi 355750757   527 EEEAARLALEEAMKQAQEQARY 548
gi 831217518  1148 EE-AIRVAQEEAMKQAQEQARY 1168
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap