Conserved Protein Domain Family
DUF4671

?
pfam15710: DUF4671 
Domain of unknown function (DUF4671)
This family of proteins is found in eukaryotes. Proteins in this family are typically between 385 and 652 amino acids in length.
Statistics
?
PSSM-Id: 318011
View PSSM: pfam15710
Aligned: 10 rows
Threshold Bit Score: 735.207
Threshold Setting Gi: 625197154
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158564134   1 MTKRKKLRTS--GEGLCPPKPLKNPRLGDFYGD-PQSSMLGCLHHPEEPEGKLGPVPSTQQHGEEPGKAVSSSPDEETGS 77
gi 119604784 140 MTKRKKLRTS--GEGLCPPKPLKNPRLGDFYGD-PQSSMLGCLHHPEEPEGKLGPVPSTQQHGEEPGKAVSSSPDEETGS 216
gi 532101462   1 MSKRKKLRTS--GEGVRPPKPPKNPRLGPSKGG-PESPDSGHLHHPEESEDSSGPAAFPELTGEEPRGAVSSSPHEETGA 77
gi 625197154   1 MNKKKQQRDS--GGDLPLSKPPKNPRLKDPHGS-PESSVLMQSQHSRESEDSSESAASVEPGGEEPQPAASSCPVEDTRA 77
gi 351711537   1 MSKRKKLRTA--GQGIHPPKPPKNPRPGDSNGG-SRSSKLGTLQHPNESEDISTPTTPTELSGQEPGPAVSS--FSEETA 75
gi 545534462   1 MSKRKKLRTS--GGGVRPPKAPKNPRLGDSGGP-PQSSEQSSLCLPEESEGRSGPIPSAEQRTEEPVQALSSSHDEEAGA 77
gi 586977022  40 MTKRKKLRTSg-GEGIRPPKLPKNPRLGDSGRP-PQSSEWGCLCLPEASEGRSGPVPSAEQRTEEPVQAASSSPAEEAQA 117
gi 558177014  20 MSKRKKLRTP--GEGIRPPKPPKHPRLGDPDGD-PQSFQFGPLGHPEESKGSSGPVPSTEQSGEESGHEASSSPDKEAGA 96
gi 803071661  55 MSKRKKLRTSg-REGLHLRKLPKNPRIEDSDGAtSQSSLLDCLHHPEESEGGSGLTPSAEQSGEEPGQAASSSPDNEADA 133
gi 545809040  34 MSKRKKLRTSggGEGIRPMKLPKISSLEDSDGV-PQSSKLGHLHHLEESEGRSGPAPSAEQSREEPEQVASSSPDTEAAA 112
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158564134  78 PCRLLRQPEKEPAPLPPSQNSFGRFVPQFAKSRKTVTRKEEMKDEDRGSGA--FSL------------------------ 131
gi 119604784 217 PCRLLRQPEKEPAPLPPSQNSFGRFVPQFAKSRKTVTRKEEMKDEDRGSGA--FSL------------------------ 270
gi 532101462  78 ASRLLRQPEKEPTPLPPSQNSVGRFVPQFAKPRKTGTRKAETREEDAENGA--VSScimpqtcdghswqseafwrqdssa 155
gi 625197154  78 VSDLPGSPE-ELVSLPPSQNSVRRFVPQFAKSKKTITRKAKAWKEVPESCP--GSQ------------------------ 130
gi 351711537  76 AASLLEQLEKEASFFPDSQTSLGRFVPQFAKPGKIVTRKAKTMEEDTERRA--VSL------------------------ 129
gi 545534462  78 PSRLFGQPEKGPVPFALSQNSARRYVPQFAKLRKTATRQAELKEEDLGSGApkISQ------------------------ 133
gi 586977022 118 PAGLHGEPEKEPAPLPLSQNSARRFVPQFAKSRKTVTRPAELREEDLRSRIpkIRQ------------------------ 173
gi 558177014  97 PSRSLSQPEKEPIPFPPSQNSDRRFVPQFAKPRKAVTRLAATREEDLGSGA--FSL------------------------ 150
gi 803071661 134 PSRLLGQPEKEPAPLPPSQNSVGKFVPQFAKPRKTVTRQAERREERLGMGV--FSS------------------------ 187
gi 545809040 113 PSRLLRQSEKEPVPFPLSQNSVGRFIPQFAKAKKTVTRQAERREEDPGGGA--FSS------------------------ 166
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158564134 132 --------------ETIAESSAQSPG--CQLLVETLGVPLQEATELGDPTQADSARPEQSSQSPVQAVPGSGDSQP---- 191
gi 119604784 271 --------------ETIAESSAQSPG--CQLLVETLGVPLQEATELGDPTQADSARPEQSSQSPVQAVPGSGDSQP---- 330
gi 532101462 156 ctmgveakasssgwDTLPVPSAQQAG--SLLLPESLGLALQEARGPGEQTQADSPSTEQSGQNLEISVPGRGDSQP---- 229
gi 625197154 131 --------------ETWPELGALQAG--SQPQKESLKFPFHDARRPEDQAWADGTCSKERTISPDTGSPGNSDFEM---- 190
gi 351711537 130 --------------EALPNPSA------PWQLEGSLG--------PRAQMPADNPHLEQSGQKPGTPVPGEG-------- 173
gi 545534462 134 --------------ETPLEPSAQQARrnSFLWEESLGLIPWEARELDAQTQVDSTHPEHRDQNSMTPVPGSGDPQPstst 199
gi 586977022 174 --------------ETPPGPSSQQAR--SRLQEESLGLASWEAREPGAQTQVDSTHPEHRDQNLMTPVPESGDSPPsast 237
gi 558177014 151 --------------ETPPEPSAQQAG--SQSWQESPELTILEAWEPGDQTQTDGTHSEHSVQNAVTPVSSRGDSQPevsn 214
gi 803071661 188 --------------GTLPEPSAQQTR--SQPQEESPGLAPQEARDLGHQTQADGTCTKPSGLSPMTPGPSDADPQPsvst 251
gi 545809040 167 --------------ETLPEPSVQQAR--NQPQEESPGLALQEARDPEDQIQADSTYPKLNSQSPM---PGSGDPQPsast 227
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158564134 192 DDPPDRGTGLSASQRASQDHLSEQGA---DDSK-------PETDRVPGDGGQKEHLPSIDSEGEKPDRGAPQEGGAQRTA 261
gi 119604784 331 DDPPDRGTGLSASQRASQDHLSEQGA---DDSK-------PETDRVPGDGGQKEHLPSIDSEGEKPDRGAPQEGGAQRTA 400
gi 532101462 230 LFSPEVGTGPSHPERASQNRLLEQSNsvmAGGNlgnsrpeTEMAWVPGDRGQKGHLPGSDAGGQGSDRGAPRGGGAQGRS 309
gi 625197154 191 -----------------------QRTtvqDSDS------------------QGRHLSDGDAEGRQADSRAPQEGDAQEGG 229
gi 351711537 174 -------TGSCNSEMASQDPVSEQGTstsDGGNlws--sgPERSQVPNDLAPKRNHPCSGAEGMKPARGAPQEGGAQNGT 244
gi 545534462 200 DASPEWDTVPLASVRA-QDHLLEQGTstpDGES-------REGCWVLGYHGQKGLLLSGDAEEKESDQGALQEASAQGGA 271
gi 586977022 238 NVSPERGMVPLASERASQDHLSEQGTntpDGES-------RKGCWVLGYHGQKGLLLSSDAEEKEPDRGSLQEAGVQGGA 310
gi 558177014 215 DISSEWGMVPLVSESASQDCLLKQGTnlpDAGS-------TEGGRIPGDLSQKGHLPSSGAEKKEPDQGVPQEEGVQGGT 287
gi 803071661 252 NTSPELGTVPSASERADQDYLSEPGTnvpKGGS-------TEEGWAPGNHSQKGRLPGSDTGEMEPEQGAPQQGGARALA 324
gi 545809040 228 SPSSECGSVPLASERTSQDHLSEHRRnmpDDGS-------TEDDWAPGDHSQHKHLPGKAVEEKEPDQGAFQERDARGGA 300
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158564134 262 GAGLPGGPQEEGDGVPCTPASAPTsgpapgLGPa------SWCLEPGSvaqGSPDPQQTPSRM----GREGEGTHSSLGC 331
gi 119604784 401 GAGLPRGPQEEGDGVPCTPASAPT------SGPapglgpaSWCLEPGSvaqGSPDPQQTPSRM----GREGEGTHSSLGC 470
gi 532101462 310 GAELPPVPKDEGASRPHTAAPAPA------VGLaqelspaTPHLKTWSvgqDLPDPRQIPGGS----GGEAGQSHSSPGC 379
gi 625197154 230 TGAQQSGEPQEGEDTLYISASAPA------------------------------SDPTVPVPThklsSTGAAPSCSSPAH 279
gi 351711537 245 --------PEEGGGITNGLVSAPT------LA-----------------------TPETPTGA----GRQAECSCGGPVC 283
gi 545534462 272 EADLPERCQEEGDSV---------------LSSi------TQDTEPRSaaqGLSDPIQMPSKT----GREAEQSCSSPRY 326
gi 586977022 311 EADLPEGHREKGDSV---------------LGPs-----sTQGPEPGSadqALSDPMQIPSKT----SREAEQSCSGPSH 366
gi 558177014 288 GTD-----QEKGDSI---------------LGLv------TQGSELGSaaqAPPDPLQILSRV----GKEAGGSCSSPRH 337
gi 803071661 325 GADLLEGLQEEGGSL---------------LGP------------------EPPSAALVPPRClqtlGREAEWSWSCPRC 371
gi 545809040 301 GADLPEGGQEEGFAA---------------QG--------------------PPDPMQTPSRT----GGEAEWSCSSPRH 341
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158564134 332 SSLGMVVIADLSTDPTELEERALEVAGPDGQASAISPASPRRKAADGGHRRALPGCTSLTGETTGESGEAGQDGKPPGDV 411
gi 119604784 471 SSLGMVVIADLSTDPTELEERALEVAGPDGQASAISPASPRRKAADGGHRRALPGCTSLTGETTGESGEAGQDGKPPGDV 550
gi 532101462 380 TSL--------SVDPTEVDQRTPEVAGPGGQ------AFPSRQAPGRGCSAAKLDCAPLAEDTTAGRGDLGLEGGPQGDM 445
gi 625197154 280 ASLTDSVLTDVSLDPSLLQQRAPEVAAL--------PGSLNGQTPGGGCSGTLLGYTPLTEETTAGREEARLEEGSPSDT 351
gi 351711537 284 ACLGSAVMENTSTDAPETEQRTLRVAGPDVQPDTQPPASPGKH--------TLQGCRSLAEETTGDRGEAEPEHEPPSDT 355
gi 545534462 327 SSLGTVVITDVSTDPTEPEQRAPEVARPDEQANTKAPTCPSGKAPDGGCSGALLSCISLTGDTG-CRGEAGWEGKPPGNI 405
gi 586977022 367 SSLGTVVITDRRTDPTEPERRAPEVAKPDEQANTRAPSSPSGKAPDGGHSGALLSCTLLTGEAG-GRREARWEDKPPGNI 445
gi 558177014 338 SSLRISVITDVVTDPTKSEQRALELTGPDEKANTQAPASPSGKAPDGGHSGALLTGLPLAGETTESRGEEGWEADSPGDV 417
gi 803071661 372 PPLGAIVITDVNTDPAEPEHKALRVAVPDREVSARVPASPSGKAPNAGRSRALLSCAPLTGVTSGGRGEAQREDEPPGDI 451
gi 545809040 342 SPLGPVVIADVNIDPTEPEQRTLKVAGPGREVNTRVPASPSGKAPDGGRSRALPVCMPLAGEITGGKGEARNEDKPPGDV 421
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158564134 412 LVGPTASLALAPGSGESMMGAGDSGHASPDTGPCVNQKQEPG----P----------------AQE-------------- 457
gi 119604784 551 LVGPTASLALAPGSGESMMGAGDSGHASPDTGPCVNQKQEPG----P----------------AQE-------------- 596
gi 532101462 446 PSSPLGFLAPASGNQTSTVCAKDSGHLALEMGPDVGQVPRPS----P----------------VQEgpgrmct-----qp 500
gi 625197154 352 LTSLIE--AAVPGKEEPMVGAGDPGHIEQEMSPAVKTKDSGSdgqlP----------------EEIgtlplea-----qp 408
gi 351711537 356 LRNPEAFWAVVLGNQEPTRDAKNPGNPVPDVGPGVHQ---PG----P----------------AAHvlpsla------ql 406
gi 545534462 406 LGGPAASQALDHSIREPTIGARDSSLLASEMGPDVDPTKVPG----L----------------DQdglgsvcmlplllqp 465
gi 586977022 446 LGGPLGSLALDRRIKEPIVGAGDSSLLASEVGPPVDQTRAPG----LdeeglggicalplllqPEge------------- 508
gi 558177014 418 SRGPAASLVLAHETQEPSVGAGCSSPIASEIDPVVGQTQVPD----L----------------DQEglegvcalsllsqp 477
gi 803071661 452 LGCFAASLPLPHETQEPTLVAGDPSLSALEMGPDVGQTQVPG----P----------------DQEglggvcsqprlsqp 511
gi 545809040 422 PGVLGASLALAQEIQEPPIGAENSGPLALEMGSGVGQTQVPG----Q----------------GQE-------------- 467
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158564134 458 ----E------------------AELGGQNLERDLEGFRVSPQASVVLEHREIADDPLQEPGAQQGIPDTTSELAGQRDH 515
gi 119604784 597 ----E------------------AELGGQNLERDLEGFRVSPQASVVLEHREIADDPLQEPGAQQGIPDTTSELAGQRDH 654
gi 532101462 501 vdrrA------------------AGLGSQGREQVLKELSLSPGASGLLELRDTVGDPPPETGAPLGSPEPSVEAAGQPQQ 562
gi 625197154 409 msqkV------------------VELSSLNCHQDVESLSLSPDTSSQLEHSHAASDLPQRTKASHSSPGIPIDLTEQQQS 470
gi 351711537 407 gdrqV------------------AESGSQCLEGGCTGLSLALCALCPPEHRAATNGPLWEARAQQGSLEAPTDPPGPLQH 468
gi 545534462 466 agkkT------------------AELSHESPEQDLEGFSLSLGAFVPPPNRETVGGLSQEARACQDSIDAPAAPTGWSAC 527
gi 586977022 509 ---kA------------------AELRSQSPKEDLDWFNLSLGAFAPPVHREAVGGPSQETRACHDHPGAPEDPTGWSEP 567
gi 558177014 478 sgekA------------------AELGSQSHEQDFGGFSPSLGASVPPLHRETVVGPPLDARAHQGNPDAPAGPAGQPKH 539
gi 803071661 512 agekA------------------AELGSPSLKQDLQGLSLSLRASAAPMYQEAAGGPPQDAGAGRGSPDTPTGPVGQPWR 573
gi 545809040 468 ----EiggvcspplpsqpesekaAKLGSQGCKQDFKGLSLSFGASAPLVYREAVAGPPQDAGTHQGSPDAPAGLAGQPEQ 543
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158564134 516 LPHSADQGTWADSLAVELDFLLDSQIQDALDASDFEAPPEQ-------------------------------------LF 558
gi 119604784 655 LPHSADQGTWADSLAVELDFLLDSQIQDALDASDFEAPPEQ-------------------------------------LF 697
gi 532101462 563 PPTSSD---------LEVGFLPDSQIREALEGASFEAPPEQ-------------------------------------VS 596
gi 625197154 471 APSTRDEAAWQESSTMELDFLPDSQLQDVLDAPNLKALSEQ-------------------------------------GF 513
gi 351711537 469 SLDSLSQAGWPESLTMELDFLPDSQLRDALDAPDLEAPLEQ-------------------------------------DA 511
gi 545534462 528 PPGSVDQAVLGESLALEPDFVPDSQMQKALEAPDFETSHEQvlqdeqetvprlrhqeqshrpaqispskrtssagdtrLF 607
gi 586977022 568 PPGSADQALLGESPAMEPHFLPDSQIRDALEVPDLAASPEQ-------------------------------------LF 610
gi 558177014 540 -PDPADQA------ALELDFLPDSQIQDALEALNLEAPPEQ--------------------------------------F 574
gi 803071661 574 PTDSSKQAIWEGSPAMELDFLPDSQIQDALEAPGFEAPPEQ-------------------------------------LF 616
gi 545809040 544 PPDSSEQAFWGESPAMELDFLPDSQIQNALESPGFEAPPEQ-------------------------------------LF 586
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158564134 559 PSGNKPGPCWPGPSSHANGD-PVAVAKAQPRTFVGIQASEASRMEDATNVVRGLIVELSNLNRLIMGTHRDLEAFKRLN- 636
gi 119604784 698 PSGNKPGPCWPGPSSHANGD-PVAVAKAQPRTFVGIQASEASRMEDATNVVRGLIVELSNLNRLIMGTHRDLEAFKRLN- 775
gi 532101462 597 PAGSESGLCWPDPSPRARGD-LVMMAQVQPS-------------------------------RLIMSAHRDLEAFRRLH- 643
gi 625197154 514 PAGNEPGHGGPVPNPDVIGGsPKAVAKSQPRPPMGTWAQEAFRMQDATDTVRGLVVELSSLNRLIMSTHRDLEAFKR--- 590
gi 351711537 512 STENESGLCWPCPSLSAGGGnRVPVVEAQPSGGRPACSLPSLRIEDASDTVHGLIVELSNLNRLIMSAHRDLEAFKRLS- 590
gi 545534462 608 PTGSRLDSCWPGTSPQADGG---LLTEFQlRTCVGIKACEAARMEDATDTVQGLIVELSNLNRLIMSAHRDLEAFKRLS- 683
gi 586977022 611 PLGSRLDSRWPGTSLHADGG---PLTDFQlRTCVGIKACEAARMEDATDTVRGLVVELSNLNRLIMSTHRDLEAFRRLN- 686
gi 558177014 575 PAGSGVGPCWPGTSLSTEGG---PLIESQPSAHKGIKPREATRMEDATDTMRGLIIELSNLNRLIMNAHRDLEAFKRLN- 650
gi 803071661 617 PAGGELDPCRPGTGPRADRG---SCAEAQPRTRVGIKTCEATGIEDATDTVRGLVMELSNLNRLIMSAHRDLETFKRLNy 693
gi 545809040 587 PAGSGLGPCCPGTSPCADGN---PFAEAQLRTRAGIKTCEAARMEDATETVRGLVIELSNLNRLIMCAHRDLEAFKRFNy 663
                        810       820       830
                 ....*....|....*....|....*....|...
gi 158564134 637 YRKTKLGGKAPLPYP-SKGPGNIPRGDPPWREL 668
gi 119604784 776 YRKTKLGGKAPLPYP-SKGPGNIPRGDPPWREL 807
gi 532101462 644 SRKAKPPGKAPSLYP-PK--GSLSRGEQAWRDL 673
gi 625197154 591 -RKAK-----PLPYL-TKGLGSLARGDQGWREL 616
gi 351711537 591 SRKAR-----PLPWP-PKGAGAVSRGEQPWRDL 617
gi 545534462 684 YRKARLAGKGPAPYT-SKGAGNLPPEERSWRDL 715
gi 586977022 687 YRKARPAGKAPAPYT-SKGAGNLPPGERSWRDL 718
gi 558177014 651 YRKAKPAGKAPMPYT-SKGAGALPRGEQPWRDL 682
gi 803071661 694 YRKAKPAGKAPTPYTeQGGWGPLPRGEQSWRDL 726
gi 545809040 664 YRKAKPAGKAPTPHP-PKWAGT-PRGEQSWRDL 694
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap