Conserved Protein Domain Family
MNR

?
pfam15718: MNR 
Protein moonraker
Protein moonraker is a centriolar satellite component involved in centriole duplication. It promotes centriole duplication by localizing WDR62 to the centrosome.
Statistics
?
PSSM-Id: 318019
View PSSM: pfam15718
Aligned: 11 rows
Threshold Bit Score: 1285.92
Threshold Setting Gi: 874477950
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 532103575   1 MGPGHPAPTCVHLMSRTQLD-GTSHLRKFQTQNQLQFNRNVPPHSSNLAVQYSCPHAIRIEKLKHSYNETYCGKDSDFRV 79
gi 752433088   1 MGPGRPASASACLAPSVQLH-GRSDPRTLQAQNQLQFNRSVPAHSSDLAVRYSCPHAIRIEKLNHSYSESRHQQDLGLRG 79
gi 345800268   1 MGPGRPASACAHLVPSIQVD-GSTEPHMRQTQNQLQFNRSVPTHPSNLAVRYSCPHAIRIEKLRHSYTESHHHQDLGFRD 79
gi 545859829   2 MGPGRPASTCDHLASSVQLD-ERNDPRKLQTQNQLQFNRNVPTHSSNLAIRYSCPHGIRIEKLKHSCNESDQCRD----- 75
gi 558178560   2 MGPGRPASTCVNHASSVQLD-GRSDPWRLQTQNQLQFNKNVPTHSSNLAIRYSYPHAIKIEKLKHSHTESDHCKDLDFGD 80
gi 332250988   1 MGPGQPASTCVHLAPRTQLD-GKSDPQVLQTQNQLQFNRNVATHSSNLAIRYSCPHAIRIEKLKHSYDDSYHCKD---GD 76
gi 514460443   2 MGPSQPASTCVHVASCTQEG-GTNDPRKLQTQNQLQFNRSVPAHPSNLAVQYSCPHGIRIEKLKHSYNESRY-KDSDFRV 79
gi 109488483   1 MGPSQPASTCVHLASSLQLD-GMTDPRNLQPQNQLQFNRNVPTDPSNLAVRYSCPHGIKIEKLKHSYNELHHGKDLDFGA 79
gi 874477950   1 MGPSKPSLSGAPFASTAQLY--RNEGKTLQTQ--LQFNRNVPAVPENLALRFSNPCPIIIEKLKPSTDQ----RNLSGID 72
gi 556950106  15 tDPNHPHESWIPSSLGNKFKtSQNKPQLYQTQ--LKFNREVSTLPDNLAVRFSNPPPIVIEKLSHSHDQKKQDED---DD 89
gi 344290070   1 MGPGEPVPACVRLAPDVHLG-GRCDPREFQTQNQLQFNRNVPTHSSSLAIRYSCPHAIRIEKLKHSYNESHHCKDVSSRD 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 532103575  80 GPDLSSSVSFSVISEERLSYAVHLAKRDVKRRQFEEHIKEHHLK---SQPQSSQKCGHTKYKVSDHKVERKDAKDQEVCQ 156
gi 752433088  80 GPDGSGSASFSIISEERLSRAVQLAKRDVKRRQLEEHVQQHRLR---SEPQLSQRGEPHKQQIPEHRAPRKGPRSREMCR 156
gi 345800268  80 GPDVSGSASFSIISEERLSFAVHLAKRDVKRRHFEEHVKQHHLS---REPQVSQAWGPHKHSMPEHRTQRKELSSRETCL 156
gi 545859829  76 GPDLSSSVSFSVISEERLSYAVHLAKRDVKRRQLEEHIKERHLG---SQPRVAQQCGRAKHDVSAQRLERKESKRQG--- 149
gi 558178560  81 GPDLSSSVSFSVVSEERLSYAVHLAKRDMKRRHFEEHVKKHHLT---SQSQISPKCGCTKHKKSDLGVERKELKNQEAFH 157
gi 332250988  77 GPDLGSSVSFSVISEERLSYAVHLARRDVKRRQFEEHIKEHHLR---SRPQSSQKCGHTKYKIPDHRVERKESKSQAACQ 153
gi 514460443  80 GPDLSSSVPFSVISEEKLSYAVHLAKRDIKRRQFEEH----YLR---SQPSNSQKCRHTKHKISDHGTERKDPKNQEIHR 152
gi 109488483  80 GNELSSSVSFSVISEERLSYAVHLAKRDVKRRQFEEHVKD-HLR---SQPQSSHKCMHTK-------VERKDSKSQDVCH 148
gi 874477950  73 NSSIKSSGKFSIISEERLKQAIQLAKRDMKRKHLEEQMKQKVLGdavSESLLTQKSQQQKNKVFESPEKKNVLKSQTELK 152
gi 556950106  90 ARSSRSSIAFSVVSEDRLNFAIQMAKRDIRRHRLEEQVKEYVHKldqSKSKSGQEAQRPRNKALEKTKEGGQAKTDKASR 169
gi 344290070  80 GPDLSSSVSFSVISEEKLSYAVHLAKRDVKRRQFEEHVKGHHLR---SQPQTPQKCGHMKsgipehrLERKETKRQEGFP 156
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 532103575 157 CSHQ---PSKVGISSSGAKVYVYTSHPGHSDLTLLNSPPTRDPGLQLQSRIADHknvceqKSLFEVQRLQKELSNCIHRI 233
gi 752433088 157 CAHQ---PSTVAASCSGAKVYLCTPCPARSPPAVPQSPPTRDPGLEPQPRISGH------QSLQEVQRLQRELNTCIHKM 227
gi 345800268 157 CGCQ---PSPVGASCSGAKVYLHTPRPTLSWPAELHSPPTCDPGLEPHARIGSH------HGLLEVQRLQKELNTCIQKM 227
gi 545859829 150 -RRQ---PSKVEISSSGATVYLCTSPPGQSELPKPNSPPTRDPGLQP-PTAGDHkslcehKTLLEVQRLQKELSSCIQKI 224
gi 558178560 158 CNHQ---PSKVEISSSGAKVYVYTSHAGQSGLTMPNSPPTHDPGLRPHGRTGDHkslcehRRLLEVQRLQKILSNCIHKI 234
gi 332250988 154 CSHQ---PSKVEISSSGAKVYLYSSHPGQSELTVPNSPPTHDPGLQPHPRIGDHkniseqKSLLEVQRLQKELSSCIHKI 230
gi 514460443 153 CSHQ---PSEVGLSSSGAKVYVYTSHHGQSALTMPNSPPTHDPGPHPQPKIGDHkssceqKSLLEVQRLQKELSSCIQKI 229
gi 109488483 149 CSHQ---PSKVSISSSGAKVYVYTSHRGRADLPMPNSPPTHDPGPQPQPRIEEHrnlweqKGLLEVQRLQKELSSCIHKI 225
gi 874477950 153 YQGKlgqPSRVETTSSGAKVYLYTPSEGRLTPAVLGSSPTHNMRPDTKPNVNKKe----dKSRQEIQRLQKELRSCIQKI 228
gi 556950106 170 RRHQasqASGVEVTSSGAKVYIYTPDRSQSRPVSLDSPPTHDPG--PGAKNEDH------KSIQEIRRLRQELGSYIQKI 241
gi 344290070 157 HSHQ---PSRVEISSSGAKVYLYTSHPGQSDLTVPNSPPTRDPGLQPHPKTGEH------KSLLEVQRLQKELSSCIHKI 227
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 532103575 234 EEVTKKDRLEEALDPDEERRIRVRRQEQAVRCARMLYVLQQQVKEIQEELDKLSPHKIKHTKKSWAMSRLAAAHRGAIRA 313
gi 752433088 228 EEVTKKDRAEAVLDPDEERRVRVRRQEQAARSARMLYVLQQQVREIQEELDKLSPHKIRHTKKSWAMSRLAAAHRGAIRA 307
gi 345800268 228 EEVAQRDRTEEALDPDEERRVRIRRQEQAVRSARMLYVLQQQVKEIQEELDKLSPQKIRHTKKSWAMSRLAAAHRGAIRA 307
gi 545859829 225 EEVTKKDRMEEALDPDEERRVRVRRQEQAVRSARVLYVLQQQVKEIQEELDKLSPHKIKHTKKSWAVSRLAAAHRGAIRA 304
gi 558178560 235 EEVTK-DKMEEALDPDEERRVRVRRQEQAVRSARMLYVLQQQVREIQEELDKLSPHNIKHTKKSWAMSRLASAYRGAVQA 313
gi 332250988 231 EEVTKKDRLEEALDPDEERRIRIRRQEQAARSARMLYVLQQQVKEIQEELDKLSPHKIKHTKKSWAMSKLAAAHRGAIRA 310
gi 514460443 230 EEVTKKDRLEEALDPEEEQRVRVRRQEQTVRCARMLYVLQQQVKEIQEELDKLSPNKIKHTKKSWAMSRLATAHRGAIRA 309
gi 109488483 226 EGLTKKDRLEEALDPDEEHRIRVRRQEQAVRSARMLYVLQQQVKEIQEELDKLSPRKIKHTKKSWAMSRLAAAHRAAIRA 305
gi 874477950 229 EELIKKERVEEILDRDEEQQVCTRRQKQASRSARMLYVLQQQVKEIQDDLEKLSPHEIKHTKKSQAVSRLAAAHRGAIRA 308
gi 556950106 242 EELAKTDRAEEMLDPDEERRAQTRRKEQAVRSARMLYVLQQQVKEIQEELEKLSPHKIKHTKKTRAMSRLAAAHRGAVRA 321
gi 344290070 228 EEVTKKDKIEEALDPDEERRVRTRRQEQAVRSARMLYVLQQQVKEIQEELDKLSPHKIKHTKKSWAMSRLAAAHRGAIRA 307
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 532103575 314 LQMFVTQFTDRGEHPVSARCKELGSLIRQLSLCSAKLDA--DPSVPDVVIDILQQIEALESLLEKKLSPKKVKKCFSENR 391
gi 752433088 308 LQVLVTQLTDRGEHPVPARCRELGGLIRQLSLCSARLNA--DSPVPDVVADILRQIEALECLLEKKLSPKKVKKSFTEIQ 385
gi 345800268 308 LQVLVTQLTDRGEHPVPARCRELGSLIRQLSLCSARLDT--DPSVPDVVVDILRQIEALESLLEKKVSPKKVKTCSADLR 385
gi 545859829 305 LQMFVTQFTDRGEHPLPARCRELGSLIRQLSLCSAKLEA--DSSVPDVVIDILQQIEALESLLEKKLSPKKAKQCFSEIR 382
gi 558178560 314 LQMFVTQFTDRGEHPIPAQYRELGSLIRQLSLCSAKVDA--DSSVSDVVIDILQQIEALESLLEKKLSPKKVKKNFTEIS 391
gi 332250988 311 LQMFVTQFTDRGEHPLPARCKELGSLIRQLSLCSAKLDA--DPSVPDVVIDILQQIEALESLLEKKLSPKKVKKCFSEIR 388
gi 514460443 310 LQMFVTQFTDRGEHPIPARCRELGSLIRQLSLCSAKLDA--NPSIPDVVIDILQQIEALESLLEKKLSPKKVKKCFSEIQ 387
gi 109488483 306 LQVFITQFTDRGEHPVPARCRELGSLIRQLSLCSAKLDV--DPSVPDVVIDILQQIEALESLLEKKLSPKKAKKCFTEIR 383
gi 874477950 309 LQAFANQFTDQTEQLIPTHYKELGSLIRQLSLCSAKLEV--DSSVSDIIIDILLQIEDLDSLLEKKQAAKKSKKCLTASQ 386
gi 556950106 322 LQLFVTQLTDPSEQQVPAHYKELGHLIRQLSLCSAKLEAgpDSAVPENIIDILQQVEDLDSFLQRKHSPKKLQKSHSRTR 401
gi 344290070 308 LQMFVTQFTDRGEYPVPARGRELGSLIRQLSLCSAKLDS--DPSVPDVVIDILQQIEDLESLLEKKLSPKKVKRCVSEVR 385
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 532103575 392 -KYPISNQRTLGKWPDTLPKGERRPFVSKETLPQDTI-RPSVAKKLLSDKNQP-NAEFLATQRLERELEVLDVDILPEEV 468
gi 752433088 386 sRFPVGSHRALEGWQSPSPKSERRSLVAKETFPEETR-WPSGTKTLLAGKCPP-GAAPVATWTLENGLDAMGAEIFPEEA 463
gi 345800268 386 rKFPVGSHGASERRHSPSPQSQRRPLVAKETLPQEAT-GSLGTRKLSTEKCLP-GAVPAVTQSSE---DAMDAEILLEEA 460
gi 545859829 383 sRFPVGTQRALDRWRSTSPKSERRPLVAKEVFLQETR-RPPVAKKLLTDKHHPdDVELPVTPRLEKELDVLDAEILPEEA 461
gi 558178560 392 sKFPVDSPRSLERSQSTLPKSERRPFVTKKILPKETR-QPSVAKKVLADKYPP-DVELPRTPRLENELEALDADILPEEA 469
gi 332250988 389 sRFPIGSQKALERWPSTSPKGERRPLTAKDTFPQETC-RPSVAKQLLADKYQP-DMELPETQRLQSELDVLDVDILPEEG 466
gi 514460443 388 sQFPVGSQKAIEKWPRTFPKSERPVLVAKETFPREAH-RPSVARKLLVDKRQP-DTELPVTARLESELDGLDVGILMEEA 465
gi 109488483 384 sRFPIGSQKILERWPTVLPKSERRPLVTKETFPQETS-RPSVAKRLLADVGQP-----DELQRLERELDALDTGIPPQEA 457
gi 874477950 387 hKFPVNTETSPGRKQLTSPKGGKKSVILKEKHGQEPRkFPAA-----RDKLQH-VTNISAVQKMNSHAHILHNKFQEEND 460
gi 556950106 402 sRSPENKERSPAKQHTTSPGKGKTIPSSKEKGPQEQK-TSSVAKRLSTDDNQL-ALEAPKTQQSNSRGPPPCHDRQPEDD 479
gi 344290070 386 nKFPVGSPKALEKWPSTSSKSERSLPGAKEMFPQEMR-RPAVAKKLLADKHRPvTEL-PGTKRLEDELDVLPVDILQEEA 463
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 532103575 469 PLIPDQNASFKDEALTLAKTGVVKTKPVTESV-PFRKKDTLEPARPQQGLHKAERNRPSHPPSKS-RVQQTTVSSRLKMN 546
gi 752433088 464 PSAADHSASFPADALAPARAGAAAGRPTARST-VLRKKEAQAPARLPQGLHKAEKSRPTQSQSRS-RLQRTTVSSRLKMN 541
gi 345800268 461 LPAPDPSASLLAEPLVLARARAAVVRPVAGST-ALRKKEAQVSVRLPQGPHRAERSRPPASQSRS-RLQRTTVSSRLKVS 538
gi 545859829 462 PSILDPNTSFK-EALALPKARAVKKKLVTENVpPFRKKDTLAAARLQQGLHKAEKSRPTQSYSKS-RLQRTTVSSRLKMN 539
gi 558178560 470 LTILDQNASFKEEALAPAKTKAAGKRPVTDNV-PSRRKDALAPARSQQGLQKAEKSRPTQSQGKS-RLHQTTVSSRLKIN 547
gi 332250988 467 PFILDQSASFKDEVLAVAKTKAVKKKSVTENV-PFRKKDTLAPAR-QQGLRKAERSRQSQPHSKS-RVQQTTVSSRLKMN 543
gi 514460443 466 PLVLDQTTNFKEEALALAKAGAAKKKSKTENV-LFRKKDILEPAGSQQGLHKAEISRPGQPHSRN-RLHQTTVSSRLKMN 543
gi 109488483 458 SHILDHGTDFKDETLTPVKPQAVRKKTVTGHM-PLRKKDTSESARSQQGLHISERNRPNQPYSKS-RLQQTTVSSRLKMN 535
gi 874477950 461 LPTPERNAVLKGSIDSQSRSRAVKKDLILESV-PLKKKELILPVKS-QGMLKPQKRRQVQPQGKHaQFQDTTIAFQLKEN 538
gi 556950106 480 PPTPDRNAVLKAGLEALIRAGALKKRTAAESV-SSVNKGVLLPERL-QGFRQPREMKPTQQARRAdHFQQATVASRLKEN 557
gi 344290070 464 PPILDQSASFKDEMSALVKARVVKKKPATVNA-PFRKRDALAPVRPQQGLHRAERCRPTQPHIKS-RLHQTTVSSRLKMN 541
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 532103575 547 QQPVKSHRAPWIPANPTSPPASPKC-AAWLRVKSSPTDAAKEQSFQQEDTQe------GSQL-SVVKHESNRLAWLEAES 618
gi 752433088 542 QQPVRDNRAPWVPPNPTSPPASPKC-AAWLKVKPSPRDARKEQSLQQDEAQ-------EETLtGAVVQEAVRLAWLDAET 613
gi 345800268 539 QQPMREHRAPWVPPNPTSPPASPKC-AAWLKVKPSPRGATREPSVPQAKAQv------QSPSrGAVVQEAARLAWLDAEA 611
gi 545859829 540 QQPVKNHRAPWIPPNPTSPPASPKC-AAWLKVKSSPTDATKEQSLQPEDAPe------ESQLrGAIAHEAARLAWLDVET 612
gi 558178560 548 QQPLKDTRAPWIPPNPTSPQASPKC-AAWLKVKPSPKDTTKEQSVEQESAQe------ESQLgGAVEHEAVRLAWLDAET 620
gi 332250988 544 RQPVKDRKAPWIPPNPTSPPASPKC-AAWLKVKTSPRDATKEP-LQQEDPQe------ESHLtGAVEHEAARLAWLDAET 615
gi 514460443 544 RQPVRDHRAPWIPPHPTSPPASPKC-AAWLKVKRSPRNAAKEECLHQEGVSe------EGQPtGATEQEAARLAWLDAKS 616
gi 109488483 536 RQPVKDHRAPWIPPNPTSPPASPKC-AAWLRGKYNPRDAAKVQSLQQETTHr------ESQLgGAAEQEAARLSWPDAES 608
gi 874477950 539 KRLVKENRTPWVPPNPTSPPASLKRaYRISRTASSKKLIHKHSALQKGKT--------EERRlGLMEKEALrfevpassh 610
gi 556950106 558 QPHVKGSSTPWIPPNPTSPPASPKR-APWKKQRVSFK-TSRPKSVDNRDQTallkeivEKERrSAAEKEAVRLAWLDTEE 635
gi 344290070 542 QQPVKDQRAPWIPPNPTSPPASPKC-AAWTKVKHSSKEATKEQSLQQEDTQe------ESHWqGAIEHEAARLAWLDAET 614
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 532103575 619 SKRLKELEELKAKEMDQMQKQRldwldaetsrrtkelnelkteemdrlqklsISASQLADKVEEAVLERLKPLLVKAQRV 698
gi 752433088 614 CKTLKELEDLKAEGSDKTQRRS------------------------------VSDTQLADKVEKAVLERLKPLLVKAQRV 663
gi 345800268 612 CKTLKELEELKAEGSDQTQQQs------------------------------VSAAQLAEKVEVAVLERLQPLLLKAQRV 661
gi 545859829 613 SKRLKALEELKDEEMDRMQKQRldwldaetskrtkelnelkseevdrlhklsVSATQLADKVEKAVLERLKPLLVKAQRV 692
gi 558178560 621 SKRLKELGELKAEEMDKMQNQs------------------------------VSATQLADQVEKAVLERLKPLLAQAQRV 670
gi 332250988 616 SKRLKELEELKAKETDNMQKQRldwldaetsrrtkelnelkaeemyrlqqlsVSATQLADKVEEAVLDRLKPLLVKAQRV 695
gi 514460443 617 SKGSKELEDLKAREMDRMQRQRldwldaetsrrtkelnklkseemdrlhklsVSATQLADKVEAAVLERLKPLLVKAQRV 696
gi 109488483 609 SKRLKELEELEAKELERKQKQRldwleaetsrrtkeldelkaeemarlqklsVSATQLADKVEEAVLERLKPLLIKAQRV 688
gi 874477950 611 aKRMKVLTDLSKGEMEKIKKLRsq---------------------------gASPTQYVDKIEKAVQKHLEPPLDRVQ-- 661
gi 556950106 636 ARRMRELKELCKEEIDKIQKMrs---------------------------eaGSPSRWADKVEKAVRDRLHPLLDRAQEI 688
gi 344290070 615 SKRLKELEELKTKEMDKIQKWRldwldaetsrrtkelnelkteeidrleklsVSATQLADKVEQAVLERLKPLLAKAQRV 694
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 532103575 699 NSSTEANIHLKDRPSFNTA----AAQPAEQATAVNSESINIHQ-LDYFLEDTAHELWAMTHAKIFGS-ETSPTLRDSKDI 772
gi 752433088 664 NSSLEADPQLKDRPSADTV----TARLTEEAAAVDCAPHSLCQ-LGDSLGDAAHGPRVATHHGVLES-EASAPVGDGRDS 737
gi 345800268 662 NSSLEADANPRDQPPTDTA----TAQPVQE---------------------------AAVLDPLRDHlEASALVGGGRDS 710
gi 545859829 693 NSSLEADSHLKNQPSVNAA----TARPAEEAPAIDCGPSNIRQ-LDDFLDDTAHELWAVTHSKILES-DTLATLGDSRDS 766
gi 558178560 671 NSSVGADTHLKDHPSVNTG----TAQPAEEATALDCKSNNNPQ-LDDILEDTTRELRAVTHSKILEP-DALATLGDGL-- 742
gi 332250988 696 NSTAEANIHLKDGSSVNTA----TAQPAQEVAAVDFESNNIRQ-LDDFLEDSAHELWAVTHAKILGS-ETLATVEDSKDS 769
gi 514460443 697 NSSVEADMPLKDRPSSDTA-----ARPAEQDTAANSESNNLHP-PNNFLEDAAHELWAVTHDKILGS-ENLDTLWGGKNS 769
gi 109488483 689 NSSVEVNGHLKDLPSRSRAaaptAAQPAVQASDVHFESRNICQ-LDDCLEDSAHELRAVTHDKILGS-ETSTRLGDSKDS 766
gi 874477950 662 ----------------------------QVAANADILSEKV---LDDLLKDTAQELQNTEQQKKLQA-EELI-----ADS 704
gi 556950106 689 SDSWEKKTQLKNSSLKYQL----SSQAADKVTGSADLLS--EKlLDDLLEDTAQELWNIEHDHKLHK-DAIGM----QDS 757
gi 344290070 695 NSSLHANSRLKDRPSVNTA----ASQPTEETAAVDSESSNIRL-PDDFLDDTTHKLWAVTHPEILE---------DSKDA 760
                        810       820       830       840       850       860       870       880
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 532103575 773 PNLEIMMLRMEEMEKYQETVRQRYNKIVYADPHLWIQEVGNDQKIPTVSESplspPLSPHPIRITKTAARKDPAVNIVLE 852
gi 752433088 738 PYLETLMLRMEEMEKYQEAVRQRYNKIVYADPHLWTQEGETEQTLPAVSER----PLSPHPIRITKTSALKDPDVSIVLE 813
gi 345800268 711 PYLETLMLRMEEIENYQETVRQRYNKIVYADPHHWMQEGKTEQTLAAVSER----PLSPHPIRITKTAARKNPDVNIVLE 786
gi 545859829 767 PYLETMMLRMEEMEKYQETVRQRYSKIVYTDPHLWMQEEKKDQNIPAVSER----PLSPHPIRITKTAARKDPDVNIVLE 842
gi 558178560 743 -CLETMLLRMEEMEKYQETVRQRYNKIVYSDPQFWMQEEKNDQKLAAVSEG----PLSPHPIRITKTVASKDPDVHIVLE 817
gi 332250988 770 PDLEMMMRRMEEMEKYQESVRQRYNKIAYADPRLWMQEENNDQKISAISEK----PLSPHPIRITKTVDRKDPAVNIMLE 845
gi 514460443 770 PNLETMMLRMEEMEKYQETVRQRYSKIVYTDPHLWMQEERNDQKTPAVSER----PLPPPLIKITKTAVHKDPAINIVLE 845
gi 109488483 767 PDLETMMLRMEEMEKYQETVRQRYNKIVYADPHLWTHEERNDQNTPAVSER----PLASHPIKITKTATRKCPEVNILLE 842
gi 874477950 705 PSLETMLQRMEEIERYQAAVCRRFTQIVYSDSKFWAQEMD--QQSALTAKI----PTSPHPIHITKLTQHIEPETDILIE 778
gi 556950106 758 STLETMLQRIDEMERYQLSVRRRFNQIVYADPEFWAQEERKDRETVSIDRK----SETPRPIRLTKLAGKFEPEMDIVLQ 833
gi 344290070 761 PTLETMMLRMEEMEKYQEIVRQRYNKFVYADPQFWMQEEKKDQKVPAVREG----PLPPHPIRITKTVAHKDPDVNIVLE 836
                        890       900       910       920       930       940       950       960
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 532103575 853 KPCNG-NSLDESVGTEERSEKREASLPSPAED-SQQREGQTPLFVPPGMRHSIGDYCSRFEQYLRIIAHEAVGSFNPWLI 930
gi 752433088 814 RPQNG-NSLDESVGTDEGSEKRGAPLAPLPEE-CPQKEGRAALHVPLALRHSIGDYCSRFERYLRLVAHEAVGAFNPWLM 891
gi 345800268 787 RPQTG-NSLDESMGPDKGSDKRGVPLLPLPEE-YPRKEGQAALRVPPGLRHSISDYCSRFEQYLRLVGHEAVGTFNPWLL 864
gi 545859829 843 RPCNS-TSLDESVGTEERSEKREAPLLSLSED-SLQREGRVALSVPPGMWRSIGDYCSRFEHYLRVVAHEAVGAFNPWLI 920
gi 558178560 818 RPWNG-NSLDDSMGTEEKSEKREAPLLFPSED-SEQRKGRTALLVPPGMRRSIGDYCSRYDQYLRMVSHEAVGSFNPWLI 895
gi 332250988 846 RPCNG-NSLDESVGTEEGSEKREAPLLSLAED-SQQKEGRAPLFVPLGMRHSIGDYCSRFEQYLRIISHEAIGSFNPWLI 923
gi 514460443 846 KPCNAdSLD-ESVETERSER-RETPLPSFAED-SLQREGRASLFVPPSMQHSISDYCSRFEQYLRIISHEAVGSFNPWLI 922
gi 109488483 843 RPCSA-NSLDESMGTEEESEKMEAPLPFFRED-LHQKEGQTPLSVPPGMRHSIGDYCSRYEQFLRIISHEAIGSFNPWLI 920
gi 874477950 779 KLFDD-NDIDENKEPKEKLLTGNDILNPLTQN-SIQKECYISLPVTKHMLQSIKDYNSRYEHHLKLIFHEAIGGFNPWQI 856
gi 556950106 834 RPLNG-DAATEFSELEERSELNDDPLWPLTQKlPLAKPGGTVLSVPGKVLQNILDYNQKFEEHLRLISHEAIGSFNPWLI 912
gi 344290070 837 RPWNG-NSLDESVETEERLKKREAPLLSLPEA-ALQKEGRALLSIPPAMLHSIGDYCSRFEQYLRMVSHEAVGSFNPWLI 914
                        970       980       990
                 ....*....|....*....|....*....|....*.
gi 532103575 931 AESFSEELVDEALGAVAAELQDVCEDYAEAVFTSEF 966
gi 752433088 892 AESFSDQLVDEALGAVAAELEDACEDYAEAVFTSEF 927
gi 345800268 865 AESFSEELVDEALGAVAAELEDACEDYAEAVFTSEF 900
gi 545859829 921 AESFSDELVDEALGAVAAELQDVCEDYAEAVFTSEF 956
gi 558178560 896 AESFSEELVDEALGSVTAELRDVCEGYAEAVFTSEF 931
gi 332250988 924 AESFSEELVDEALGAVAAELQDMCEDYAEAVFTSEF 959
gi 514460443 923 AESFSEELLDESLGFVAAELQDACEDYAEAVFTSEF 958
gi 109488483 921 AESFSDELVDEALGAVAAELQDVCEDYAEAVFTSEF 956
gi 874477950 857 AESLAEELTEEALCDVAAELQDVCEDYAEAVFTSEF 892
gi 556950106 913 AESLAEELMAEALSDVAAELQDVCEEYAEAVFTSEF 948
gi 344290070 915 AESFSDELVDEALGAVAAELQDVCEDYAEAVFTSEF 950
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap